Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101567
Name   oriT_pMFDS1009770 in_silico
Organism   Escherichia coli strain MFDS1009770
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAQMUM010000003 (67340..67463 [+], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 41..48, 61..68  (AAAAACAA..TTGTTTTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_pMFDS1009770
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGTTTTTTTAATCATTAGTTTATGTTCTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   514 GenBank   WP_032083503
Name   WP_032083503_pMFDS1009770 insolico UniProt ID   _
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14584.63 Da        Isoelectric Point: 5.0278

>WP_032083503.1 conjugal transfer relaxosome DNA-binding protein TraM [Escherichia coli]
MARVNLYISNEVHEKINMIVERRRQEGARDKDISLSGTASMLLELGLRVYDAQMERKESAFNQTEFNKLL
LECVVKTQSTVAKILGIESLSPHVSGNPKFEYASMVDDIREKVSIEMDRFFPKNDDE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure



No available structure.



ID   515 GenBank   WP_001254386
Name   WP_001254386_pMFDS1009770 insolico UniProt ID   A0A3Z6KJB5
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9005.11 Da        Isoelectric Point: 10.1422

>WP_001254386.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Gammaproteobacteria]
MRRRNARGGISRTVSVYLDEDTNNRLIKAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVTEESES
TFKEL

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(14-61)


  Protein structure


Source ID Structure
AlphaFold DB A0A3Z6KJB5


T4CP

ID   1026 GenBank   WP_001064245
Name   traC_V6M07_RS26100_pMFDS1009770 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99159.81 Da        Isoelectric Point: 5.8486

>WP_001064245.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

TraG P-loop domain (P-loop_TraG)

(467-771)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 66768..86912

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
V6M07_RS25980 62735..63169 + 435 WP_000845953 conjugation system SOS inhibitor PsiB -
V6M07_RS25985 63166..63928 + 763 Protein_79 plasmid SOS inhibition protein A -
V6M07_RS25990 63897..64085 - 189 WP_032084246 hypothetical protein -
V6M07_RS25995 64107..64256 + 150 Protein_81 plasmid maintenance protein Mok -
V6M07_RS26000 64198..64323 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
V6M07_RS26005 64543..64773 + 231 WP_074014914 hypothetical protein -
V6M07_RS26010 64771..64944 - 174 Protein_84 hypothetical protein -
V6M07_RS26015 65014..65220 + 207 WP_000547968 hypothetical protein -
V6M07_RS26020 65245..65531 + 287 Protein_86 hypothetical protein -
V6M07_RS26025 65650..66471 + 822 WP_074014913 DUF932 domain-containing protein -
V6M07_RS26030 66768..67415 - 648 WP_123007297 transglycosylase SLT domain-containing protein virB1
V6M07_RS26035 67692..68075 + 384 WP_032083503 conjugal transfer relaxosome DNA-binding protein TraM -
V6M07_RS26040 68265..68951 + 687 WP_000332492 PAS domain-containing protein -
V6M07_RS26045 69045..69272 + 228 WP_001254386 conjugal transfer relaxosome protein TraY -
V6M07_RS26050 69306..69671 + 366 WP_000340270 type IV conjugative transfer system pilin TraA -
V6M07_RS26055 69686..69997 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
V6M07_RS26060 70019..70585 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
V6M07_RS26065 70572..71300 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
V6M07_RS26070 71300..72727 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
V6M07_RS26075 72717..73307 + 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
V6M07_RS26080 73294..73491 + 198 WP_001324648 conjugal transfer protein TrbD -
V6M07_RS26085 73503..73753 + 251 Protein_99 conjugal transfer protein TrbG -
V6M07_RS26090 73750..74265 + 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
V6M07_RS26095 74400..74621 + 222 WP_001278689 conjugal transfer protein TraR -
V6M07_RS26100 74781..77408 + 2628 WP_001064245 type IV secretion system protein TraC virb4
V6M07_RS26105 77405..77791 + 387 WP_032082946 type-F conjugative transfer system protein TrbI -
V6M07_RS26110 77788..78420 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
V6M07_RS26115 78417..79409 + 993 WP_000830183 conjugal transfer pilus assembly protein TraU traU
V6M07_RS26120 79418..80056 + 639 WP_000777695 type-F conjugative transfer system pilin assembly protein TrbC trbC
V6M07_RS26125 80053..81861 + 1809 WP_096111975 type-F conjugative transfer system mating-pair stabilization protein TraN traN
V6M07_RS26130 81888..82145 + 258 WP_000864318 conjugal transfer protein TrbE -
V6M07_RS26135 82138..82881 + 744 WP_123010632 type-F conjugative transfer system pilin assembly protein TraF traF
V6M07_RS26140 82897..83244 + 348 WP_032082949 conjugal transfer protein TrbA -
V6M07_RS26145 83246..83521 - 276 WP_001513501 hypothetical protein -
V6M07_RS26150 83602..83886 + 285 WP_000624108 type-F conjugative transfer system pilin chaperone TraQ -
V6M07_RS26155 83873..84418 + 546 WP_000059818 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
V6M07_RS26160 84348..84689 + 342 WP_001442101 P-type conjugative transfer protein TrbJ -
V6M07_RS26165 84676..85068 + 393 WP_282868770 F-type conjugal transfer protein TrbF -
V6M07_RS26170 85055..86428 + 1374 WP_021532658 conjugal transfer pilus assembly protein TraH traH
V6M07_RS26175 86425..86912 + 488 WP_332831083 conjugal transfer protein TraG N-terminal domain-containing protein traG

Host bacterium

ID   2011 GenBank   NZ_JAQMUM010000003
Plasmid name   pMFDS1009770 Incompatibility group   IncFII
Plasmid size   86912 bp Coordinate of oriT [Strand]   67340..67463 [+]
Host baterium   Escherichia coli strain MFDS1009770

Cargo genes

Drug resistance gene   -
Virulence gene   estIa
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -