Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101552
Name   oriT_pL1M1-01d in_silico
Organism   Escherichia coli strain L1M1-01
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAPZDR010000004 (977..1036 [+], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_pL1M1-01d
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1375 GenBank   WP_327643590
Name   Relaxase_O8D02_RS24595_pL1M1-01d insolico UniProt ID   _
Length   185 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 185 a.a.        Molecular weight: 20541.51 Da        Isoelectric Point: 9.5883

>WP_327643590.1 relaxase/mobilization nuclease domain-containing protein, partial [Escherichia coli]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGATVLQGKPEEVRELIDASPYAKKYTSGVLSFAEAELPPGQR
EQIMASFERVLMPGLDKDQYSILWVEHTDKGRLELNFLIPNTELLTGKRLQPYYDRADRPRIDAWQTVVN
GRLGLHDPNAPKNRRLLVTPSALPETKLEAAQAITRGLLALASSG

  Protein domains


Predicted by InterproScan.

(55-164)


  Protein structure



No available structure.




Auxiliary protein


ID   494 GenBank   WP_000957082
Name   WP_000957082_pL1M1-01d insolico UniProt ID   _
Length   106 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 106 a.a.        Molecular weight: 11739.54 Da        Isoelectric Point: 9.4905

>WP_000957082.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacteriaceae]
MLTMWVTEDEHRRLLERCDGKQLAAWMRQTCLDEKPARAGRLPSISPALLRQLAGMGNNLNQIARKVNTG
GAGHDRVQIVAALMAIDAGLERLRHAVLEKGGNDDR

  Protein domains


Predicted by InterproScan.

(50-93)


  Protein structure



No available structure.



ID   495 GenBank   WP_001749519
Name   WP_001749519_pL1M1-01d insolico UniProt ID   A0A6Y5XIL9
Length   161 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 161 a.a.        Molecular weight: 17752.43 Da        Isoelectric Point: 9.6101

>WP_001749519.1 MULTISPECIES: MbeB family mobilization protein [Enterobacteriaceae]
MSSLLALAKDLEKQSKAQQQNTCEMLKAAFSEHEKSVKAELSASAKRISDAISAHEQGMTAAMQSNRLSV
LRMVGRTWLTITLVSVLLIATSGSILWWQGQQITGNYQTIRAQERTQAMLSEKNHGVQLSLCGEQKLSCV
KVNPKAGAYGEEGNWMVLERK

  Protein domains


Predicted by InterproScan.

(1-52)


  Protein structure


Source ID Structure
AlphaFold DB A0A6Y5XIL9


Host bacterium


ID   1996 GenBank   NZ_JAPZDR010000004
Plasmid name   pL1M1-01d Incompatibility group   Col440II
Plasmid size   5429 bp Coordinate of oriT [Strand]   977..1036 [+]
Host baterium   Escherichia coli strain L1M1-01

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -