Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101536
Name   oriT_2023CK-00929|unnamed1 in_silico
Organism   Klebsiella pneumoniae strain 2023CK-00929
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_ABLUVU020000002 (104123..104171 [-], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site  
 
 GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_2023CK-00929|unnamed1
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   990 GenBank   WP_040120372
Name   traD_REW78_RS00155_2023CK-00929|unnamed1 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 85972.07 Da        Isoelectric Point: 5.1806

>WP_040120372.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDTPEPGPADTNSHAGEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

(32-128)

(172-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1..19625

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
REW78_RS00060 (REW78_000060) 1..2640 + 2640 WP_013214024 type IV secretion system protein TraC virb4
REW78_RS00065 (REW78_000065) 2640..3029 + 390 WP_004167468 type-F conjugative transfer system protein TrbI -
REW78_RS00070 (REW78_000070) 3029..3664 + 636 WP_029497419 type-F conjugative transfer system protein TraW traW
REW78_RS00075 (REW78_000075) 3699..4100 + 402 WP_040120376 hypothetical protein -
REW78_RS00080 (REW78_000080) 4097..5086 + 990 WP_029497420 conjugal transfer pilus assembly protein TraU traU
REW78_RS00085 (REW78_000085) 5099..5737 + 639 WP_015065635 type-F conjugative transfer system pilin assembly protein TrbC trbC
REW78_RS00090 (REW78_000090) 5796..7751 + 1956 WP_040120375 type-F conjugative transfer system mating-pair stabilization protein TraN traN
REW78_RS00095 (REW78_000095) 7783..8037 + 255 WP_004152674 conjugal transfer protein TrbE -
REW78_RS00100 (REW78_000100) 8015..8263 + 249 WP_004152675 hypothetical protein -
REW78_RS00105 (REW78_000105) 8276..8602 + 327 WP_004144402 hypothetical protein -
REW78_RS00110 (REW78_000110) 8623..9375 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
REW78_RS00115 (REW78_000115) 9386..9625 + 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
REW78_RS00120 (REW78_000120) 9597..10154 + 558 WP_013214031 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
REW78_RS00125 (REW78_000125) 10200..10643 + 444 WP_014343488 F-type conjugal transfer protein TrbF -
REW78_RS00130 (REW78_000130) 10621..12000 + 1380 WP_072198320 conjugal transfer pilus assembly protein TraH traH
REW78_RS00135 (REW78_000135) 12000..14849 + 2850 WP_040120373 conjugal transfer mating-pair stabilization protein TraG traG
REW78_RS00140 (REW78_000140) 14855..15382 + 528 WP_040120388 conjugal transfer protein TraS -
REW78_RS00145 (REW78_000145) 15571..16302 + 732 WP_004152629 conjugal transfer complement resistance protein TraT -
REW78_RS00150 (REW78_000150) 16495..17184 + 690 WP_072198322 hypothetical protein -
REW78_RS00155 (REW78_000155) 17313..19625 + 2313 WP_040120372 type IV conjugative transfer system coupling protein TraD virb4

Region 2: 103565..110239

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
REW78_RS00655 (REW78_000655) 99613..99993 + 381 WP_020802391 hypothetical protein -
REW78_RS00660 (REW78_000660) 100060..100407 + 348 WP_032445771 hypothetical protein -
REW78_RS00665 (REW78_000665) 100502..100648 + 147 WP_004152750 hypothetical protein -
REW78_RS00670 (REW78_000670) 100699..101532 + 834 WP_032445769 N-6 DNA methylase -
REW78_RS00675 (REW78_000675) 102349..103170 + 822 WP_004152492 DUF932 domain-containing protein -
REW78_RS00680 (REW78_000680) 103203..103532 + 330 WP_011977736 DUF5983 family protein -
REW78_RS00685 (REW78_000685) 103565..104050 - 486 WP_001568108 transglycosylase SLT domain-containing protein virB1
REW78_RS00690 (REW78_000690) 104482..104874 + 393 WP_004194114 conjugal transfer relaxosome DNA-binding protein TraM -
REW78_RS00695 (REW78_000695) 105104..105805 + 702 WP_040120380 hypothetical protein -
REW78_RS00700 (REW78_000700) 105891..106091 + 201 WP_046664192 TraY domain-containing protein -
REW78_RS00705 (REW78_000705) 106159..106527 + 369 WP_004194426 type IV conjugative transfer system pilin TraA -
REW78_RS00710 (REW78_000710) 106541..106846 + 306 WP_004144424 type IV conjugative transfer system protein TraL traL
REW78_RS00715 (REW78_000715) 106866..107432 + 567 WP_004144423 type IV conjugative transfer system protein TraE traE
REW78_RS00720 (REW78_000720) 107419..108159 + 741 WP_040120379 type-F conjugative transfer system secretin TraK traK
REW78_RS00725 (REW78_000725) 108159..109583 + 1425 WP_040120378 F-type conjugal transfer pilus assembly protein TraB traB
REW78_RS00730 (REW78_000730) 109655..110239 + 585 WP_040120377 type IV conjugative transfer system lipoprotein TraV traV
REW78_RS00735 (REW78_000735) 110562..110780 + 219 WP_004195468 hypothetical protein -
REW78_RS00740 (REW78_000740) 110781..111092 + 312 WP_029497417 hypothetical protein -
REW78_RS00745 (REW78_000745) 111159..111563 + 405 WP_004197817 hypothetical protein -
REW78_RS00750 (REW78_000750) 111606..111758 + 153 WP_224518895 hypothetical protein -
REW78_RS00755 (REW78_000755) 111940..112338 + 399 WP_023179972 hypothetical protein -


Host bacterium


ID   1980 GenBank   NZ_ABLUVU020000002
Plasmid name   2023CK-00929|unnamed1 Incompatibility group   IncFII
Plasmid size   112409 bp Coordinate of oriT [Strand]   104123..104171 [-]
Host baterium   Klebsiella pneumoniae strain 2023CK-00929

Cargo genes


Drug resistance gene   blaNDM-1, aph(3')-VI, qnrS1, blaCTX-M-15, aac(6')-Ib, ant(3'')-Ia, blaOXA-9, blaTEM-1B
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9