Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101459
Name   oriT_pCRE6_4 in_silico
Organism   Klebsiella pneumoniae strain S6_CRE6
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAHBNK010000005 (12349..12447 [-], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_pCRE6_4
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1313 GenBank   WP_000130000
Name   Replic_Relax_KIN48_RS29025_pCRE6_4 insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

Transcriptional regulator PadR-like family (PadR)

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium

ID   1903 GenBank   NZ_JAHBNK010000005
Plasmid name   pCRE6_4 Incompatibility group   IncR
Plasmid size   32604 bp Coordinate of oriT [Strand]   12349..12447 [-]
Host baterium   Klebsiella pneumoniae strain S6_CRE6

Cargo genes

Drug resistance gene   dfrA12, aadA2, qacE, sul1, mph(A), aph(3')-Ia
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -