Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 101451 |
| Name | oriT_pCRE13_2 |
| Organism | Klebsiella pneumoniae strain S13_CRE13 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_JAHBNN010000003 (93552..93601 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
TGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pCRE13_2
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 923 | GenBank | WP_020277955 |
| Name | traD_KIN63_RS29440_pCRE13_2 |
UniProt ID | _ |
| Length | 770 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 85894.89 Da Isoelectric Point: 5.1129
>WP_020277955.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTTKSPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNI
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTTKSPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNI
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 92994..122039
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KIN63_RS29225 (KIN63_29140) | 89002..89358 | + | 357 | WP_019706019 | hypothetical protein | - |
| KIN63_RS29230 (KIN63_29145) | 89419..89631 | + | 213 | WP_044265048 | hypothetical protein | - |
| KIN63_RS29235 (KIN63_29150) | 89642..89866 | + | 225 | WP_014343499 | hypothetical protein | - |
| KIN63_RS29240 (KIN63_29155) | 89947..90267 | + | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| KIN63_RS29245 (KIN63_29160) | 90257..90535 | + | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| KIN63_RS29250 (KIN63_29165) | 90536..90949 | + | 414 | WP_004152722 | helix-turn-helix domain-containing protein | - |
| KIN63_RS29255 (KIN63_29170) | 91778..92599 | + | 822 | WP_004152492 | DUF932 domain-containing protein | - |
| KIN63_RS29260 (KIN63_29175) | 92632..92961 | + | 330 | WP_011977736 | DUF5983 family protein | - |
| KIN63_RS29265 (KIN63_29180) | 92994..93479 | - | 486 | WP_001568108 | transglycosylase SLT domain-containing protein | virB1 |
| KIN63_RS29270 (KIN63_29185) | 93870..94286 | + | 417 | WP_072145360 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| KIN63_RS29275 (KIN63_29190) | 94486..95205 | + | 720 | WP_015065526 | hypothetical protein | - |
| KIN63_RS29280 (KIN63_29195) | 95338..95541 | + | 204 | WP_171486139 | TraY domain-containing protein | - |
| KIN63_RS29285 (KIN63_29200) | 95606..95974 | + | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| KIN63_RS29290 (KIN63_29205) | 95988..96293 | + | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| KIN63_RS29295 (KIN63_29210) | 96313..96879 | + | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| KIN63_RS29300 (KIN63_29215) | 96866..97606 | + | 741 | WP_004152497 | type-F conjugative transfer system secretin TraK | traK |
| KIN63_RS29305 (KIN63_29220) | 97606..99030 | + | 1425 | WP_268102417 | F-type conjugal transfer pilus assembly protein TraB | traB |
| KIN63_RS29310 (KIN63_29225) | 99104..99688 | + | 585 | WP_020277945 | type IV conjugative transfer system lipoprotein TraV | traV |
| KIN63_RS29315 | 99843..100241 | + | 399 | WP_020277946 | hypothetical protein | - |
| KIN63_RS29320 | 100312..100560 | + | 249 | WP_223175793 | hypothetical protein | - |
| KIN63_RS29325 (KIN63_29235) | 100584..100802 | + | 219 | WP_004195468 | hypothetical protein | - |
| KIN63_RS29330 (KIN63_29240) | 100803..101114 | + | 312 | WP_047066479 | hypothetical protein | - |
| KIN63_RS29335 (KIN63_29245) | 101181..101585 | + | 405 | WP_004197817 | hypothetical protein | - |
| KIN63_RS29340 (KIN63_29250) | 101961..102359 | + | 399 | WP_023179972 | hypothetical protein | - |
| KIN63_RS29345 (KIN63_29255) | 102431..105070 | + | 2640 | WP_032431388 | type IV secretion system protein TraC | virb4 |
| KIN63_RS29350 (KIN63_29260) | 105070..105459 | + | 390 | WP_004167468 | type-F conjugative transfer system protein TrbI | - |
| KIN63_RS29355 (KIN63_29265) | 105459..106085 | + | 627 | WP_020277949 | type-F conjugative transfer system protein TraW | traW |
| KIN63_RS29360 (KIN63_29270) | 106127..106516 | + | 390 | WP_020277950 | hypothetical protein | - |
| KIN63_RS29365 (KIN63_29275) | 106513..107502 | + | 990 | WP_009309872 | conjugal transfer pilus assembly protein TraU | traU |
| KIN63_RS29370 (KIN63_29280) | 107515..108153 | + | 639 | WP_004152682 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| KIN63_RS29375 (KIN63_29285) | 108212..110167 | + | 1956 | WP_268019292 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| KIN63_RS29380 (KIN63_29290) | 110199..110453 | + | 255 | WP_049194392 | conjugal transfer protein TrbE | - |
| KIN63_RS29385 (KIN63_29295) | 110431..110679 | + | 249 | WP_004152675 | hypothetical protein | - |
| KIN63_RS29390 (KIN63_29300) | 110692..111018 | + | 327 | WP_004144402 | hypothetical protein | - |
| KIN63_RS29395 (KIN63_29305) | 111039..111791 | + | 753 | WP_020803149 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| KIN63_RS29400 (KIN63_29310) | 111802..112041 | + | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| KIN63_RS29405 (KIN63_29315) | 112013..112570 | + | 558 | WP_032736782 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| KIN63_RS29410 (KIN63_29320) | 112616..113059 | + | 444 | WP_020277953 | F-type conjugal transfer protein TrbF | - |
| KIN63_RS29415 (KIN63_29325) | 113037..114416 | + | 1380 | WP_014343487 | conjugal transfer pilus assembly protein TraH | traH |
| KIN63_RS29420 (KIN63_29330) | 114416..117265 | + | 2850 | WP_268102420 | conjugal transfer mating-pair stabilization protein TraG | traG |
| KIN63_RS29425 (KIN63_29335) | 117268..117801 | + | 534 | WP_080748465 | conjugal transfer protein TraS | - |
| KIN63_RS29430 (KIN63_29340) | 117987..118718 | + | 732 | WP_004152629 | conjugal transfer complement resistance protein TraT | - |
| KIN63_RS29435 (KIN63_29345) | 118911..119600 | + | 690 | WP_014343485 | hypothetical protein | - |
| KIN63_RS29440 (KIN63_29350) | 119727..122039 | + | 2313 | WP_020277955 | type IV conjugative transfer system coupling protein TraD | virb4 |
| KIN63_RS29445 (KIN63_29355) | 122039..125938 | + | 3900 | Protein_156 | conjugative transfer relaxase/helicase TraI | - |
Host bacterium
| ID | 1895 | GenBank | NZ_JAHBNN010000003 |
| Plasmid name | pCRE13_2 | Incompatibility group | IncFII |
| Plasmid size | 139182 bp | Coordinate of oriT [Strand] | 93552..93601 [-] |
| Host baterium | Klebsiella pneumoniae strain S13_CRE13 |
Cargo genes
| Drug resistance gene | aac(6')-Ib |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |