Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 101431 |
| Name | oriT_pCRE31_1 |
| Organism | Klebsiella pneumoniae strain S30_CRE31 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_JAHBNY010000004 (153999..154048 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pCRE31_1
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 912 | GenBank | WP_023313941 |
| Name | traD_KIN66_RS25730_pCRE31_1 |
UniProt ID | _ |
| Length | 769 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 769 a.a. Molecular weight: 85666.78 Da Isoelectric Point: 5.2499
>WP_023313941.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGTADTNSHAGEQPEPVSQPA
PAEVTVSPAPVKAPATTKMPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNKDGVIEDMQAYDAWADEQTLRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGTADTNSHAGEQPEPVSQPA
PAEVTVSPAPVKAPATTKMPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNKDGVIEDMQAYDAWADEQTLRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 123655..154606
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KIN66_RS25730 (KIN66_25630) | 123655..125964 | - | 2310 | WP_023313941 | type IV conjugative transfer system coupling protein TraD | virb4 |
| KIN66_RS25735 (KIN66_25635) | 126091..126780 | - | 690 | WP_013023831 | hypothetical protein | - |
| KIN66_RS25740 (KIN66_25640) | 126973..127407 | - | 435 | Protein_137 | complement resistance protein TraT | - |
| KIN66_RS25745 (KIN66_25645) | 127422..128390 | + | 969 | WP_015958259 | IS5 family transposase | - |
| KIN66_RS25750 (KIN66_25650) | 128447..128768 | - | 322 | Protein_139 | complement resistance protein TraT | - |
| KIN66_RS25755 (KIN66_25660) | 128957..129484 | - | 528 | WP_032409657 | conjugal transfer protein TraS | - |
| KIN66_RS25760 (KIN66_25665) | 129490..132339 | - | 2850 | WP_023287129 | conjugal transfer mating-pair stabilization protein TraG | traG |
| KIN66_RS25765 (KIN66_25670) | 132339..133718 | - | 1380 | WP_072159474 | conjugal transfer pilus assembly protein TraH | traH |
| KIN66_RS25770 (KIN66_25675) | 133696..134139 | - | 444 | WP_023287131 | F-type conjugal transfer protein TrbF | - |
| KIN66_RS25775 (KIN66_25680) | 134185..134742 | - | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| KIN66_RS25780 (KIN66_25685) | 134714..134953 | - | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| KIN66_RS25785 (KIN66_25690) | 134964..135716 | - | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| KIN66_RS25790 (KIN66_25695) | 135737..136063 | - | 327 | WP_004152676 | hypothetical protein | - |
| KIN66_RS25795 (KIN66_25700) | 136076..136324 | - | 249 | WP_013214029 | hypothetical protein | - |
| KIN66_RS25800 (KIN66_25705) | 136302..136556 | - | 255 | WP_023287133 | conjugal transfer protein TrbE | - |
| KIN66_RS25805 (KIN66_25710) | 136588..138543 | - | 1956 | WP_023287134 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| KIN66_RS25810 (KIN66_25715) | 138602..139249 | - | 648 | WP_064757794 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| KIN66_RS25815 (KIN66_25720) | 139328..139504 | - | 177 | WP_162866177 | hypothetical protein | - |
| KIN66_RS25820 (KIN66_25725) | 139525..140514 | - | 990 | WP_032439620 | conjugal transfer pilus assembly protein TraU | traU |
| KIN66_RS25825 (KIN66_25730) | 140511..140912 | - | 402 | WP_016831047 | hypothetical protein | - |
| KIN66_RS25830 (KIN66_25735) | 140947..141582 | - | 636 | WP_020325113 | type-F conjugative transfer system protein TraW | traW |
| KIN66_RS25835 (KIN66_25740) | 141582..141971 | - | 390 | WP_004167468 | type-F conjugative transfer system protein TrbI | - |
| KIN66_RS25840 (KIN66_25745) | 141971..144610 | - | 2640 | WP_032448278 | type IV secretion system protein TraC | virb4 |
| KIN66_RS25845 (KIN66_25750) | 144682..145080 | - | 399 | WP_072159473 | hypothetical protein | - |
| KIN66_RS25850 (KIN66_25755) | 145088..145477 | - | 390 | WP_065799586 | hypothetical protein | - |
| KIN66_RS25855 (KIN66_25760) | 145520..145924 | - | 405 | WP_016831042 | hypothetical protein | - |
| KIN66_RS25860 (KIN66_25765) | 145991..146302 | - | 312 | WP_014386200 | hypothetical protein | - |
| KIN66_RS25865 (KIN66_25770) | 146303..146521 | - | 219 | WP_014386199 | hypothetical protein | - |
| KIN66_RS25870 (KIN66_25775) | 146545..146835 | - | 291 | WP_014386198 | hypothetical protein | - |
| KIN66_RS25875 (KIN66_25780) | 146840..147250 | - | 411 | WP_014386197 | hypothetical protein | - |
| KIN66_RS25880 (KIN66_25785) | 147381..147965 | - | 585 | WP_014386196 | type IV conjugative transfer system lipoprotein TraV | traV |
| KIN66_RS25885 (KIN66_25790) | 148012..148584 | - | 573 | WP_014386195 | conjugal transfer pilus-stabilizing protein TraP | - |
| KIN66_RS25890 (KIN66_25795) | 148577..150001 | - | 1425 | WP_268202825 | F-type conjugal transfer pilus assembly protein TraB | traB |
| KIN66_RS25895 (KIN66_25800) | 150001..150741 | - | 741 | WP_014386193 | type-F conjugative transfer system secretin TraK | traK |
| KIN66_RS25900 (KIN66_25805) | 150728..151294 | - | 567 | WP_004152602 | type IV conjugative transfer system protein TraE | traE |
| KIN66_RS25905 (KIN66_25810) | 151314..151619 | - | 306 | WP_049110928 | type IV conjugative transfer system protein TraL | traL |
| KIN66_RS25910 (KIN66_25815) | 151633..152001 | - | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| KIN66_RS25915 (KIN66_25820) | 152063..152269 | - | 207 | WP_171773970 | TraY domain-containing protein | - |
| KIN66_RS25920 (KIN66_25825) | 152402..153121 | - | 720 | WP_014386192 | conjugal transfer protein | - |
| KIN66_RS25925 (KIN66_25830) | 153314..153730 | - | 417 | WP_072145360 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| KIN66_RS25930 (KIN66_25835) | 154121..154606 | + | 486 | WP_004178063 | transglycosylase SLT domain-containing protein | virB1 |
| KIN66_RS25935 (KIN66_25840) | 154639..154968 | - | 330 | WP_014386191 | DUF5983 family protein | - |
| KIN66_RS25940 (KIN66_25845) | 155001..155822 | - | 822 | WP_004182076 | DUF932 domain-containing protein | - |
| KIN66_RS25945 (KIN66_25850) | 156655..157068 | - | 414 | WP_013023817 | helix-turn-helix domain-containing protein | - |
| KIN66_RS25950 (KIN66_25855) | 157069..157347 | - | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| KIN66_RS25955 (KIN66_25860) | 157337..157657 | - | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| KIN66_RS25960 (KIN66_25865) | 157738..157962 | - | 225 | WP_014386189 | hypothetical protein | - |
| KIN66_RS25965 (KIN66_25870) | 157973..158185 | - | 213 | WP_014386188 | hypothetical protein | - |
| KIN66_RS25970 (KIN66_25875) | 158247..158573 | - | 327 | WP_014386187 | hypothetical protein | - |
Host bacterium
| ID | 1875 | GenBank | NZ_JAHBNY010000004 |
| Plasmid name | pCRE31_1 | Incompatibility group | IncFIB |
| Plasmid size | 172743 bp | Coordinate of oriT [Strand] | 153999..154048 [+] |
| Host baterium | Klebsiella pneumoniae strain S30_CRE31 |
Cargo genes
| Drug resistance gene | blaTEM-1B, aph(6)-Id, aph(3'')-Ib, sul2, blaCTX-M-15, dfrA14, blaOXA-1, aac(6')-Ib-cr, tet(A), qnrB1, aac(3)-IIa |
| Virulence gene | - |
| Metal resistance gene | silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE, arsB, arsC, arsH |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |