Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 101426 |
| Name | oriT_pCRE23_2 |
| Organism | Klebsiella pneumoniae strain S23_CRE23 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_JAHBNS010000003 (11618..11667 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
TGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pCRE23_2
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 908 | GenBank | WP_020277955 |
| Name | traD_KIN51_RS29180_pCRE23_2 |
UniProt ID | _ |
| Length | 770 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 85894.89 Da Isoelectric Point: 5.1129
>WP_020277955.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTTKSPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNI
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTTKSPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNI
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 11060..40105
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KIN51_RS28965 (KIN51_28880) | 7068..7424 | + | 357 | WP_019706019 | hypothetical protein | - |
| KIN51_RS28970 (KIN51_28885) | 7485..7697 | + | 213 | WP_044265048 | hypothetical protein | - |
| KIN51_RS28975 (KIN51_28890) | 7708..7932 | + | 225 | WP_014343499 | hypothetical protein | - |
| KIN51_RS28980 (KIN51_28895) | 8013..8333 | + | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| KIN51_RS28985 (KIN51_28900) | 8323..8601 | + | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| KIN51_RS28990 (KIN51_28905) | 8602..9015 | + | 414 | WP_004152722 | helix-turn-helix domain-containing protein | - |
| KIN51_RS28995 (KIN51_28910) | 9844..10665 | + | 822 | WP_004152492 | DUF932 domain-containing protein | - |
| KIN51_RS29000 (KIN51_28915) | 10698..11027 | + | 330 | WP_011977736 | DUF5983 family protein | - |
| KIN51_RS29005 (KIN51_28920) | 11060..11545 | - | 486 | WP_001568108 | transglycosylase SLT domain-containing protein | virB1 |
| KIN51_RS29010 (KIN51_28925) | 11936..12352 | + | 417 | WP_072145360 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| KIN51_RS29015 (KIN51_28930) | 12552..13271 | + | 720 | WP_015065526 | hypothetical protein | - |
| KIN51_RS29020 (KIN51_28935) | 13404..13607 | + | 204 | WP_171486139 | TraY domain-containing protein | - |
| KIN51_RS29025 (KIN51_28940) | 13672..14040 | + | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| KIN51_RS29030 (KIN51_28945) | 14054..14359 | + | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| KIN51_RS29035 (KIN51_28950) | 14379..14945 | + | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| KIN51_RS29040 (KIN51_28955) | 14932..15672 | + | 741 | WP_004152497 | type-F conjugative transfer system secretin TraK | traK |
| KIN51_RS29045 (KIN51_28960) | 15672..17096 | + | 1425 | WP_268019287 | F-type conjugal transfer pilus assembly protein TraB | traB |
| KIN51_RS29050 (KIN51_28965) | 17170..17754 | + | 585 | WP_020277945 | type IV conjugative transfer system lipoprotein TraV | traV |
| KIN51_RS29055 | 17909..18307 | + | 399 | WP_020277946 | hypothetical protein | - |
| KIN51_RS29060 | 18378..18626 | + | 249 | WP_223175793 | hypothetical protein | - |
| KIN51_RS29065 (KIN51_28975) | 18650..18868 | + | 219 | WP_004195468 | hypothetical protein | - |
| KIN51_RS29070 (KIN51_28980) | 18869..19180 | + | 312 | WP_047066479 | hypothetical protein | - |
| KIN51_RS29075 (KIN51_28985) | 19247..19651 | + | 405 | WP_004197817 | hypothetical protein | - |
| KIN51_RS29080 (KIN51_28990) | 20027..20425 | + | 399 | WP_023179972 | hypothetical protein | - |
| KIN51_RS29085 (KIN51_28995) | 20497..23136 | + | 2640 | WP_032431388 | type IV secretion system protein TraC | virb4 |
| KIN51_RS29090 (KIN51_29000) | 23136..23525 | + | 390 | WP_004167468 | type-F conjugative transfer system protein TrbI | - |
| KIN51_RS29095 (KIN51_29005) | 23525..24151 | + | 627 | WP_020277949 | type-F conjugative transfer system protein TraW | traW |
| KIN51_RS29100 (KIN51_29010) | 24193..24582 | + | 390 | WP_020277950 | hypothetical protein | - |
| KIN51_RS29105 (KIN51_29015) | 24579..25568 | + | 990 | WP_009309872 | conjugal transfer pilus assembly protein TraU | traU |
| KIN51_RS29110 (KIN51_29020) | 25581..26219 | + | 639 | WP_004152682 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| KIN51_RS29115 (KIN51_29025) | 26278..28233 | + | 1956 | WP_020277951 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| KIN51_RS29120 (KIN51_29030) | 28265..28519 | + | 255 | WP_049194392 | conjugal transfer protein TrbE | - |
| KIN51_RS29125 (KIN51_29035) | 28497..28745 | + | 249 | WP_004152675 | hypothetical protein | - |
| KIN51_RS29130 (KIN51_29040) | 28758..29084 | + | 327 | WP_004144402 | hypothetical protein | - |
| KIN51_RS29135 (KIN51_29045) | 29105..29857 | + | 753 | WP_020803149 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| KIN51_RS29140 (KIN51_29050) | 29868..30107 | + | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| KIN51_RS29145 (KIN51_29055) | 30079..30636 | + | 558 | WP_032736782 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| KIN51_RS29150 (KIN51_29060) | 30682..31125 | + | 444 | WP_020277953 | F-type conjugal transfer protein TrbF | - |
| KIN51_RS29155 (KIN51_29065) | 31103..32482 | + | 1380 | WP_014343487 | conjugal transfer pilus assembly protein TraH | traH |
| KIN51_RS29160 (KIN51_29070) | 32482..35331 | + | 2850 | WP_268019293 | conjugal transfer mating-pair stabilization protein TraG | traG |
| KIN51_RS29165 (KIN51_29075) | 35334..35867 | + | 534 | WP_080748465 | conjugal transfer protein TraS | - |
| KIN51_RS29170 (KIN51_29080) | 36053..36784 | + | 732 | WP_004152629 | conjugal transfer complement resistance protein TraT | - |
| KIN51_RS29175 (KIN51_29085) | 36977..37666 | + | 690 | WP_014343485 | hypothetical protein | - |
| KIN51_RS29180 (KIN51_29090) | 37793..40105 | + | 2313 | WP_020277955 | type IV conjugative transfer system coupling protein TraD | virb4 |
| KIN51_RS29185 (KIN51_29095) | 40105..44004 | + | 3900 | Protein_52 | conjugative transfer relaxase/helicase TraI | - |
Host bacterium
| ID | 1870 | GenBank | NZ_JAHBNS010000003 |
| Plasmid name | pCRE23_2 | Incompatibility group | IncFII |
| Plasmid size | 127726 bp | Coordinate of oriT [Strand] | 11618..11667 [-] |
| Host baterium | Klebsiella pneumoniae strain S23_CRE23 |
Cargo genes
| Drug resistance gene | aac(6')-Ib |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |