Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101402
Name   oriT_pK020_1 in_silico
Organism   Klebsiella pneumoniae strain 20
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_SBIL01000003 (195993..196042 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pK020_1
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTCATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   896 GenBank   WP_031944110
Name   traD_EJB37_RS27165_pK020_1 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 86032.08 Da        Isoelectric Point: 5.0175

>WP_031944110.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Gammaproteobacteria]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKRPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDEVEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 179540..196600

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EJB37_RS27165 (EJB37_27355) 179540..181852 - 2313 WP_031944110 type IV conjugative transfer system coupling protein TraD virb4
EJB37_RS27170 (EJB37_27360) 182212..182943 - 732 WP_004152629 conjugal transfer complement resistance protein TraT -
EJB37_RS27175 (EJB37_27365) 183133..183660 - 528 WP_004153030 hypothetical protein -
EJB37_RS27180 (EJB37_27370) 183666..186632 - 2967 WP_164960319 TraC family protein virb4
EJB37_RS27185 (EJB37_27375) 186704..187102 - 399 WP_004153071 hypothetical protein -
EJB37_RS27190 (EJB37_27385) 187398..187802 - 405 WP_031944109 hypothetical protein -
EJB37_RS27195 (EJB37_27390) 187869..188186 - 318 WP_004152595 hypothetical protein -
EJB37_RS27200 (EJB37_27395) 188187..188405 - 219 WP_004171484 hypothetical protein -
EJB37_RS27205 (EJB37_27400) 188429..188719 - 291 WP_004152596 hypothetical protein -
EJB37_RS27210 (EJB37_27405) 188724..189134 - 411 WP_004152597 lipase chaperone -
EJB37_RS27215 (EJB37_27410) 189266..189835 - 570 WP_004152598 type IV conjugative transfer system lipoprotein TraV traV
EJB37_RS27220 (EJB37_27415) 189858..190454 - 597 WP_004152599 conjugal transfer pilus-stabilizing protein TraP -
EJB37_RS27225 (EJB37_27420) 190447..191871 - 1425 WP_004152600 F-type conjugal transfer pilus assembly protein TraB traB
EJB37_RS27230 (EJB37_27425) 191871..192611 - 741 WP_004152601 type-F conjugative transfer system secretin TraK traK
EJB37_RS27235 (EJB37_27430) 192598..193164 - 567 WP_004152602 type IV conjugative transfer system protein TraE traE
EJB37_RS27240 (EJB37_27435) 193184..193489 - 306 WP_004178059 type IV conjugative transfer system protein TraL traL
EJB37_RS27245 (EJB37_27440) 193503..193871 - 369 WP_004178060 type IV conjugative transfer system pilin TraA -
EJB37_RS27250 (EJB37_27445) 193925..194296 - 372 WP_004208838 TraY domain-containing protein -
EJB37_RS27255 (EJB37_27450) 194380..195075 - 696 WP_004178061 transcriptional regulator TraJ family protein -
EJB37_RS27260 (EJB37_27455) 195289..195681 - 393 WP_004178062 conjugal transfer relaxosome DNA-binding protein TraM -
EJB37_RS27265 (EJB37_27460) 196115..196600 + 486 WP_004178063 transglycosylase SLT domain-containing protein virB1
EJB37_RS27270 (EJB37_27465) 196633..196962 - 330 WP_011977736 DUF5983 family protein -
EJB37_RS27275 (EJB37_27470) 196995..197816 - 822 WP_004178064 DUF932 domain-containing protein -
EJB37_RS27295 (EJB37_27490) 198650..199063 - 414 WP_004152722 helix-turn-helix domain-containing protein -
EJB37_RS27300 (EJB37_27495) 199064..199342 - 279 WP_004152721 helix-turn-helix transcriptional regulator -
EJB37_RS27305 (EJB37_27500) 199332..199652 - 321 WP_004152720 type II toxin-antitoxin system RelE/ParE family toxin -
EJB37_RS27310 (EJB37_27505) 199733..199957 - 225 WP_004152719 hypothetical protein -
EJB37_RS27315 (EJB37_27510) 199968..200180 - 213 WP_004152718 hypothetical protein -
EJB37_RS27320 (EJB37_27515) 200241..200597 - 357 WP_004152717 hypothetical protein -
EJB37_RS27335 (EJB37_27525) 201233..201583 - 351 WP_004152758 hypothetical protein -

Host bacterium

ID   1846 GenBank   NZ_SBIL01000003
Plasmid name   pK020_1 Incompatibility group   IncFIB
Plasmid size   223494 bp Coordinate of oriT [Strand]   195993..196042 [+]
Host baterium   Klebsiella pneumoniae strain 20

Cargo genes

Drug resistance gene   blaSCO-1, aac(3)-IIa, blaTEM-1B, blaCTX-M-15
Virulence gene   -
Metal resistance gene   silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE, arsH, arsC, arsB, arsA, arsD, arsR, merE, merD, merA, merC, merP, merT, merR, fecD, fecE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9