Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101399
Name   oriT_CPKp171210|unnamed1 in_silico
Organism   Klebsiella pneumoniae strain CPKp171210
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_WMHR01000003 (93783..93831 [-], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site  
 
 GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_CPKp171210|unnamed1
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   892 GenBank   WP_117251425
Name   traD_F8B39_RS26830_CPKp171210|unnamed1 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 85943.03 Da        Isoelectric Point: 5.1183

>WP_117251425.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

(32-128)

(172-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1635..21386

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F8B39_RS26715 6..317 + 312 WP_029497417 hypothetical protein -
F8B39_RS26720 384..788 + 405 WP_004197817 hypothetical protein -
F8B39_RS29045 (F8B39_05277) 831..983 + 153 WP_224518895 hypothetical protein -
F8B39_RS26730 (F8B39_05278) 1165..1563 + 399 WP_023179972 hypothetical protein -
F8B39_RS26735 (F8B39_05279) 1635..4274 + 2640 WP_013214024 type IV secretion system protein TraC virb4
F8B39_RS26740 (F8B39_05280) 4274..4663 + 390 WP_064291687 type-F conjugative transfer system protein TrbI -
F8B39_RS26745 (F8B39_05281) 4663..5298 + 636 WP_020325113 type-F conjugative transfer system protein TraW traW
F8B39_RS26750 (F8B39_05282) 5333..5734 + 402 WP_004194979 hypothetical protein -
F8B39_RS26755 (F8B39_05283) 5731..6720 + 990 WP_029497420 conjugal transfer pilus assembly protein TraU traU
F8B39_RS26760 (F8B39_05284) 6733..7371 + 639 WP_015065635 type-F conjugative transfer system pilin assembly protein TrbC trbC
F8B39_RS26765 (F8B39_05285) 7430..9385 + 1956 WP_101455617 type-F conjugative transfer system mating-pair stabilization protein TraN traN
F8B39_RS26770 (F8B39_05286) 9417..9671 + 255 WP_004152674 conjugal transfer protein TrbE -
F8B39_RS26775 (F8B39_05287) 9649..9897 + 249 WP_004152675 hypothetical protein -
F8B39_RS26780 (F8B39_05288) 9910..10236 + 327 WP_004144402 hypothetical protein -
F8B39_RS26785 (F8B39_05289) 10257..11009 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
F8B39_RS26790 (F8B39_05290) 11020..11259 + 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
F8B39_RS26795 (F8B39_05291) 11231..11788 + 558 WP_013214031 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
F8B39_RS26800 (F8B39_05292) 11834..12277 + 444 WP_101455614 F-type conjugal transfer protein TrbF -
F8B39_RS26805 (F8B39_05293) 12255..13634 + 1380 WP_072198320 conjugal transfer pilus assembly protein TraH traH
F8B39_RS26810 (F8B39_05294) 13634..16456 + 2823 WP_101455613 conjugal transfer mating-pair stabilization protein TraG traG
F8B39_RS26815 (F8B39_05295) 16479..17081 + 603 WP_013214035 conjugal transfer protein TraS -
F8B39_RS26820 (F8B39_05296) 17332..18063 + 732 WP_016831056 conjugal transfer complement resistance protein TraT -
F8B39_RS28660 (F8B39_05297) 18256..18945 + 690 WP_162375242 hypothetical protein -
F8B39_RS26830 (F8B39_05298) 19074..21386 + 2313 WP_117251425 type IV conjugative transfer system coupling protein TraD virb4

Region 2: 93225..99899

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F8B39_RS27225 (F8B39_05375) 88327..88677 + 351 WP_004153414 hypothetical protein -
F8B39_RS27230 (F8B39_05376) 89307..89660 + 354 WP_004152748 hypothetical protein -
F8B39_RS27235 (F8B39_05377) 89717..90064 + 348 WP_004152749 hypothetical protein -
F8B39_RS27240 (F8B39_05378) 90159..90305 + 147 WP_004152750 hypothetical protein -
F8B39_RS27245 (F8B39_05379) 90356..91189 + 834 WP_004152751 N-6 DNA methylase -
F8B39_RS27250 (F8B39_05380) 92009..92830 + 822 WP_004152492 DUF932 domain-containing protein -
F8B39_RS27255 (F8B39_05381) 92863..93192 + 330 WP_011977736 DUF5983 family protein -
F8B39_RS27260 (F8B39_05382) 93225..93710 - 486 WP_001568108 transglycosylase SLT domain-containing protein virB1
F8B39_RS27265 (F8B39_05383) 94142..94534 + 393 WP_004194114 conjugal transfer relaxosome DNA-binding protein TraM -
F8B39_RS27270 (F8B39_05384) 94764..95465 + 702 WP_004194113 hypothetical protein -
F8B39_RS27275 95550..95750 + 201 WP_046664192 TraY domain-containing protein -
F8B39_RS27280 (F8B39_05385) 95818..96186 + 369 WP_004194426 type IV conjugative transfer system pilin TraA -
F8B39_RS27285 (F8B39_05386) 96200..96505 + 306 WP_004144424 type IV conjugative transfer system protein TraL traL
F8B39_RS27290 (F8B39_05387) 96525..97091 + 567 WP_064161971 type IV conjugative transfer system protein TraE traE
F8B39_RS27295 (F8B39_05388) 97078..97818 + 741 WP_064169777 type-F conjugative transfer system secretin TraK traK
F8B39_RS27300 (F8B39_05389) 97818..99242 + 1425 WP_040228261 F-type conjugal transfer pilus assembly protein TraB traB
F8B39_RS27305 (F8B39_05390) 99315..99899 + 585 WP_040120377 type IV conjugative transfer system lipoprotein TraV traV


Host bacterium


ID   1843 GenBank   NZ_WMHR01000003
Plasmid name   CPKp171210|unnamed1 Incompatibility group   IncFII
Plasmid size   100435 bp Coordinate of oriT [Strand]   93783..93831 [-]
Host baterium   Klebsiella pneumoniae strain CPKp171210

Cargo genes


Drug resistance gene   qnrS1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9