Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101394
Name   oriT_Ea77|unnamed07 in_silico
Organism   Klebsiella aerogenes strain Ea77
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LYDO01000035 (16459..16563 [+], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      32..37, 40..45  (GCCGGC..GCCGGC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 105 nt

>oriT_Ea77|unnamed07
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1276 GenBank   WP_004206924
Name   traI_A8M83_RS26365_Ea77|unnamed07 insolico UniProt ID   A0A2V4FJ40
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A2V4FJ40


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 19361..35737

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A8M83_RS26345 (A8M83_26365) 14445..14756 + 312 WP_004187333 hypothetical protein -
A8M83_RS26350 (A8M83_26370) 14889..15425 + 537 WP_004206920 hypothetical protein -
A8M83_RS26355 (A8M83_26375) 15926..16291 - 366 WP_004206922 hypothetical protein -
A8M83_RS26360 (A8M83_26380) 16567..16884 + 318 WP_004206923 plasmid mobilization protein MobA -
A8M83_RS26365 (A8M83_26385) 16871..18850 + 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
A8M83_RS26370 (A8M83_26390) 18864..19364 + 501 WP_004206925 DotD/TraH family lipoprotein -
A8M83_RS26375 (A8M83_26395) 19361..20140 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
A8M83_RS26380 (A8M83_26400) 20151..21314 + 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
A8M83_RS26385 (A8M83_26405) 21304..21564 + 261 WP_004187310 IcmT/TraK family protein traK
A8M83_RS29200 21589..24894 + 3306 WP_219818010 LPD7 domain-containing protein -
A8M83_RS26395 (A8M83_26415) 24860..25372 + 513 WP_011091071 hypothetical protein traL
A8M83_RS26400 (A8M83_26420) 25373..25585 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
A8M83_RS26405 (A8M83_26425) 25557..25967 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
A8M83_RS26410 (A8M83_26430) 26035..26748 + 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
A8M83_RS26420 26757..27908 + 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
A8M83_RS26425 (A8M83_26445) 27920..29269 + 1350 WP_004206932 conjugal transfer protein TraO traO
A8M83_RS26430 (A8M83_26450) 29281..29985 + 705 WP_004206933 conjugal transfer protein TraP traP
A8M83_RS26435 (A8M83_26455) 30009..30539 + 531 WP_004187478 conjugal transfer protein TraQ traQ
A8M83_RS26440 (A8M83_26460) 30556..30945 + 390 WP_011154472 DUF6750 family protein traR
A8M83_RS26445 (A8M83_26465) 30991..31485 + 495 WP_004187480 hypothetical protein -
A8M83_RS26450 (A8M83_26470) 31482..34532 + 3051 WP_011154474 conjugative transfer protein traU
A8M83_RS26455 (A8M83_26475) 34529..35737 + 1209 WP_004187486 conjugal transfer protein TraW traW
A8M83_RS26460 (A8M83_26480) 35734..36272 + 539 WP_069625240 TraX-like protein -


Host bacterium


ID   1838 GenBank   NZ_LYDO01000035
Plasmid name   Ea77|unnamed07 Incompatibility group   -
Plasmid size   36272 bp Coordinate of oriT [Strand]   16459..16563 [+]
Host baterium   Klebsiella aerogenes strain Ea77

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -