Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101388
Name   oriT_pHNNC189-2 in_silico
Organism   Raoultella ornithinolytica strain Nonyl 4-3
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAGQDL010000004 (207574..207623 [-], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..13, 18..24  (GCAAAAT..ATTTTGC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pHNNC189-2
AAATCTGCAAAATATTAATTTTGCGTGGGGTGTGGTGATTTAGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   882 GenBank   WP_032736842
Name   traD_J9871_RS27995_pHNNC189-2 insolico UniProt ID   _
Length   764 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 764 a.a.        Molecular weight: 85398.61 Da        Isoelectric Point: 5.0675

>WP_032736842.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTISYYGKSLEYNAEQILADKYTIWCGEQLWTAFVFAAIVSLTICVVTFFVASWVLGRQGKL
QSEDENTGGRQLSDKPKDVARQMKRDGAASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMRGDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYNPRPKIAEGFIQRRLDTRIDERLSAQLEAREAEGSLVRALFTPDEPVSEPAEEKAGVQPEQTKPAKDS
VLPVPVKTSSMAAEGAGKTPAVPLSGAPVTRVKTVPLIRPKPAASVTGTAAAASTAAVSATAGGTEQELA
QQPVEADQDMLPAGMNEDGVIEDMQAYDAWLEGEQIQRDMQRREEVNINHSRSEQDDIEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1..21448

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J9871_RS27885 1..1422 + 1422 WP_032736866 F-type conjugal transfer pilus assembly protein TraB traB
J9871_RS27890 1596..2165 + 570 WP_042946293 type IV conjugative transfer system lipoprotein TraV traV
J9871_RS27895 2277..2555 + 279 WP_032736865 hypothetical protein -
J9871_RS30230 2640..3041 + 402 WP_228297638 hypothetical protein -
J9871_RS27905 3038..3337 + 300 WP_032736863 hypothetical protein -
J9871_RS27910 3425..3808 + 384 WP_042946290 hypothetical protein -
J9871_RS27915 3901..6540 + 2640 WP_032736861 type IV secretion system protein TraC virb4
J9871_RS27920 6540..6929 + 390 WP_032736860 type-F conjugative transfer system protein TrbI -
J9871_RS27925 6926..7552 + 627 WP_042946288 type-F conjugative transfer system protein TraW traW
J9871_RS27930 7596..8555 + 960 WP_266098000 conjugal transfer pilus assembly protein TraU traU
J9871_RS27935 8568..9194 + 627 WP_032736857 type-F conjugative transfer system pilin assembly protein TrbC trbC
J9871_RS27940 9191..11134 + 1944 WP_032736856 type-F conjugative transfer system mating-pair stabilization protein TraN traN
J9871_RS27945 11248..11859 + 612 WP_032736855 hypothetical protein -
J9871_RS27950 11849..12085 + 237 WP_032736854 conjugal transfer protein TrbE -
J9871_RS27955 12082..12267 + 186 WP_032736852 hypothetical protein -
J9871_RS27960 12314..12640 + 327 WP_032736851 hypothetical protein -
J9871_RS27965 12661..13413 + 753 WP_211843944 type-F conjugative transfer system pilin assembly protein TraF traF
J9871_RS27970 13424..13660 + 237 WP_032736848 type-F conjugative transfer system pilin chaperone TraQ -
J9871_RS27975 13647..14210 + 564 WP_224250969 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
J9871_RS27980 14197..15567 + 1371 WP_032736846 conjugal transfer pilus assembly protein TraH traH
J9871_RS27985 15567..18409 + 2843 Protein_20 conjugal transfer mating-pair stabilization protein TraG -
J9871_RS27990 18420..18947 + 528 WP_032736843 hypothetical protein -
J9871_RS27995 19154..21448 + 2295 WP_032736842 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   1832 GenBank   NZ_JAGQDL010000004
Plasmid name   pHNNC189-2 Incompatibility group   IncFII
Plasmid size   211610 bp Coordinate of oriT [Strand]   207574..207623 [-]
Host baterium   Raoultella ornithinolytica strain Nonyl 4-3

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   pcoE, pcoS, pcoR, pcoD, pcoC, pcoB, pcoA, silP, silA, silB, silF, silC, silR, silS, silE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -