Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101374
Name   oriT_FEX675|unnamed5 in_silico
Organism   Escherichia coli strain FEX675
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_PSNU01000026 (67023..67095 [+], 73 nt)
oriT length   73 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 73 nt

>oriT_FEX675|unnamed5
GTCGGGGCAAAGCCCTGACCAGGTGGGGAATGTCTGAGTGCGCGTGCGCGGTCCGACATTCCCACATCCTGTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1261 GenBank   WP_029391987
Name   Relaxase_C4M77_RS19455_FEX675|unnamed5 insolico UniProt ID   A0A2H5C199
Length   906 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 906 a.a.        Molecular weight: 105112.51 Da        Isoelectric Point: 8.2682

>WP_029391987.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Enterobacteriaceae]
MNAIIPHKRRDGRSSFEDLIAYTSVRDDVQENELTEDSEIKSDVPHRNRFRRLVDYATRLRNEKFVSLID
VMKDGSQWVNFYGVTCFHNCNSLETAAEEMQYKADKAVFSRNDTDPVFHYILSWPAHESPRPEQLFDCVR
HTLKSLELSKHQYVAAVHTDTDNLHVHVAVNRVHPETGYINWLSWSQEKLSRACRELELKHGFAPDNGCF
VHAPGNRIVRKTALVRERRNAWRRGKKQTFREYIAQMSIAGLREEPAQDWLSLHKRLASDGLYITMQEGE
LVVKDGWDRAREGVALSSFGPSWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
SLKQYACRHFAERLPEMARNGELESCLDVHRTLAKAGLWMGIQHGHLVLHDGFDKQQTPVRADSVWPLMT
LDYMQDLDGGWQPVPKDIFTQVIPGERFRGHSIGTQAVSDYEWYRMRMGTGPQGAIKRELFSDKESLWGY
ALIQCRSQIEEMIAGGDFSWQACHEMFARKGLMLQKQHHGLVIVDAFNHELTPVKASSIHPDLTLSRAEP
QAGPFEIAGADIFERVKPECRYNPELAASDEVEPGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRK
PDLRYGERLREIHAACRRRKAYIRVQFRDPQVRKLHYHIAEVQRMQALIRLKESVKEERLSLIAEGKWYP
LSYRQWVEQQAAQGDRAAVSQLRGWDYRDRRSRNKDKRRTTNADRCVVLCEPGGTPLFNNVAKLEARLQK
NGSVHFRDTRTGKNVCTDYGDRVVFYHHTDRNELAEKLDLIAPVLFSRNGKLGFEPEGSYQQFNDVFAEM
VAWHNAAGITGNGHFTITRPDVDLHRQRSEQYYREYIRQQTRLSESHDDNYTLRQEKTWEPPSPGM

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-315)


  Protein structure


Source ID Structure
AlphaFold DB A0A2H5C199


Auxiliary protein

ID   445 GenBank   WP_001291058
Name   WP_001291058_FEX675|unnamed5 insolico UniProt ID   A0A7I0L241
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12730.52 Da        Isoelectric Point: 9.9656

>WP_001291058.1 MULTISPECIES: plasmid mobilization protein MobA [Enterobacteriaceae]
MSEKKTRTGSENRKRIVKFTARFTEDEAEIVREKAESSGQTVSTFIRSSSLDKVVNCRTDDRMIDEIMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITEYVNALRRDLMGR

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A7I0L241


T4CP

ID   870 GenBank   WP_029392471
Name   trbC_C4M77_RS19450_FEX675|unnamed5 insolico UniProt ID   _
Length   766 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 766 a.a.        Molecular weight: 87239.20 Da        Isoelectric Point: 6.6676

>WP_029392471.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSQHHVNPDLIHRTAWGNPLWNALHNLNIIGLCLAGSIITALIWPLALPVCLLFTLVTSVIFTLQRWRCP
LRMPMTLSLDDPSQDRKVRRSLFSFWPTLFQYEADETSPARGIFYVGYRRINDIGRELWLSMDDLTRHII
FFSTTGGGKTETTFAWLLNPLCWGRGFTFVDGKAQNDTTRTIWYLSRRFGREDDIEVINFMNGGKSRSEI
IQSGEKSRPQSNTWNPFAFSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVRERKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDMSLVRTPSAWTEEPRKQHAYLSGQFSE
TFTTFAETFGDVFAADAGDIDIRDSIHSDRILIVMIPALDTSAHTTSALGRMFITQQSMILARDLGYRLE
GTDAQTLEVKKYKGRFPYICILDEVGAYYTDRIAVEATQVRSLEFSLIMMAQDQERIEGQTSATNTATLM
QNAGTKFAGRIVSDDKTARTVKNAAGEEARARMGSLQRHDGLMGESWVDGNQITIQMESKIDVQDLIRLN
AGEFFTVFQGDVVPSASVYIPDSEKSCDSDPVVINRYIAIEAPRLERLRRLVPRTVQRRLPTPEHVSSII
GVLTEKTSRKRRKKHTEPYRIIDTFQDQLKRTQTSLDLLPQYDTDIESRANELWKKAVHTINNTTREERR
VCYITLNRPEEEHSGPEDIPSVKAILNTLLPLEILLPVAENNKSQTINNDHPQKSCGAQPTTDEKY

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(439-528)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 15245..61436

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C4M77_RS19130 (C4M77_19130) 10476..12095 + 1620 WP_021532696 PilN family type IVB pilus formation outer membrane protein -
C4M77_RS19135 (C4M77_19135) 12116..13411 + 1296 WP_021532697 type 4b pilus protein PilO2 -
C4M77_RS19140 (C4M77_19140) 13401..13853 + 453 WP_021532698 type IV pilus biogenesis protein PilP -
C4M77_RS19145 (C4M77_19145) 13902..14456 + 555 WP_021532699 hypothetical protein -
C4M77_RS19150 (C4M77_19150) 14474..15148 + 675 WP_224466094 hypothetical protein -
C4M77_RS19155 (C4M77_19155) 15245..16753 + 1509 WP_021532701 ATPase, T2SS/T4P/T4SS family virB11
C4M77_RS19160 (C4M77_19160) 16755..17855 + 1101 WP_029391916 type II secretion system F family protein -
C4M77_RS19165 (C4M77_19165) 17906..18442 + 537 WP_029391915 type 4 pilus major pilin -
C4M77_RS19170 (C4M77_19170) 18501..18977 + 477 WP_029391914 lytic transglycosylase domain-containing protein virB1
C4M77_RS19175 (C4M77_19175) 18937..19644 + 708 WP_202110611 A24 family peptidase -
C4M77_RS19180 (C4M77_19180) 19641..20888 + 1248 WP_104209198 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
C4M77_RS19190 (C4M77_19190) 21120..21509 + 390 Protein_27 phage tail protein -
C4M77_RS29480 21514..21999 - 486 WP_236918925 prepilin, shufflon protein A -
C4M77_RS19210 (C4M77_19210) 22178..22516 - 339 WP_244060229 shufflon protein B -
C4M77_RS19215 (C4M77_19215) 23067..24236 + 1170 WP_029391926 site-specific integrase -
C4M77_RS19220 (C4M77_19220) 24277..24558 + 282 WP_029391927 hypothetical protein -
C4M77_RS19225 (C4M77_19225) 24677..25222 + 546 WP_029391928 hypothetical protein -
C4M77_RS19230 (C4M77_19230) 25473..26294 + 822 WP_000804089 hypothetical protein traE
C4M77_RS19235 (C4M77_19235) 26384..27586 + 1203 WP_029391929 conjugal transfer protein TraF -
C4M77_RS28950 27726..27896 + 171 WP_001597011 hypothetical protein -
C4M77_RS19240 (C4M77_19240) 27945..28397 + 453 WP_001081199 DotD/TraH family lipoprotein -
C4M77_RS19245 (C4M77_19245) 28394..29230 + 837 WP_029391930 type IV secretory system conjugative DNA transfer family protein traI
C4M77_RS19250 (C4M77_19250) 29214..30362 + 1149 WP_000625247 plasmid transfer ATPase TraJ virB11
C4M77_RS19255 (C4M77_19255) 30359..30649 + 291 WP_000817799 hypothetical protein traK
C4M77_RS19260 (C4M77_19260) 30713..34774 + 4062 WP_029391931 LPD7 domain-containing protein -
C4M77_RS19265 (C4M77_19265) 34791..35141 + 351 WP_021532713 hypothetical protein traL
C4M77_RS19270 (C4M77_19270) 35153..35848 + 696 WP_029391932 DotI/IcmL family type IV secretion protein traM
C4M77_RS19275 (C4M77_19275) 35859..36833 + 975 WP_029391933 DotH/IcmK family type IV secretion protein traN
C4M77_RS19280 (C4M77_19280) 36837..38168 + 1332 WP_029391934 conjugal transfer protein TraO traO
C4M77_RS19285 (C4M77_19285) 38165..38878 + 714 WP_021532717 conjugal transfer protein TraP traP
C4M77_RS19290 (C4M77_19290) 38875..39405 + 531 WP_000987022 conjugal transfer protein TraQ traQ
C4M77_RS19295 (C4M77_19295) 39452..39850 + 399 WP_029391936 DUF6750 family protein traR
C4M77_RS29830 (C4M77_19300) 39907..40158 + 252 WP_021532719 hypothetical protein -
C4M77_RS19305 (C4M77_19305) 40250..40891 + 642 WP_021532720 hypothetical protein traT
C4M77_RS19310 (C4M77_19310) 40946..41131 + 186 WP_029394194 hypothetical protein -
C4M77_RS19315 (C4M77_19315) 41228..42490 + 1263 WP_000608644 IS1380-like element ISEcp1 family transposase -
C4M77_RS19320 (C4M77_19320) 42814..43959 + 1146 WP_000976514 extended-spectrum class C beta-lactamase CMY-2 -
C4M77_RS19325 (C4M77_19325) 44053..44586 + 534 WP_001221666 lipocalin family protein -
C4M77_RS19330 (C4M77_19330) 44583..44900 - 318 WP_000118520 quaternary ammonium compound efflux SMR transporter SugE -
C4M77_RS19335 (C4M77_19335) 45096..45404 + 309 WP_029391941 hypothetical protein -
C4M77_RS19340 (C4M77_19340) 45404..45784 + 381 WP_000690886 hypothetical protein -
C4M77_RS19345 (C4M77_19345) 45960..49004 + 3045 WP_029391942 conjugal transfer protein traU
C4M77_RS19350 (C4M77_19350) 49004..49621 + 618 WP_029391943 hypothetical protein traV
C4M77_RS19355 (C4M77_19355) 49582..50787 + 1206 WP_029391944 conjugal transfer protein TraW traW
C4M77_RS19360 (C4M77_19360) 50784..51353 + 570 WP_000650755 conjugal transfer protein TraX -
C4M77_RS19365 (C4M77_19365) 51426..53591 + 2166 WP_029391945 DotA/TraY family protein traY
C4M77_RS19370 (C4M77_19370) 53679..54332 + 654 WP_029391946 plasmid IncI1-type surface exclusion protein ExcA -
C4M77_RS19375 (C4M77_19375) 54397..54606 - 210 WP_000062946 HEAT repeat domain-containing protein -
C4M77_RS29490 (C4M77_19380) 54701..54832 + 132 Protein_64 ethanolamine utilization protein EutE -
C4M77_RS19390 (C4M77_19390) 55146..55298 - 153 WP_021532728 Hok/Gef family protein -
C4M77_RS19395 (C4M77_19395) 55627..55869 + 243 WP_029391947 hypothetical protein -
C4M77_RS19405 (C4M77_19405) 56168..56536 + 369 WP_029391948 hypothetical protein -
C4M77_RS19410 (C4M77_19410) 56540..56755 + 216 WP_000266543 hypothetical protein -
C4M77_RS19420 (C4M77_19420) 56953..57576 - 624 WP_001155252 helix-turn-helix domain-containing protein -
C4M77_RS19425 (C4M77_19425) 57736..58203 + 468 WP_000598962 thermonuclease family protein -
C4M77_RS28955 58354..58530 + 177 WP_032172741 hypothetical protein -
C4M77_RS29835 58593..58676 - 84 WP_271298668 DinQ-like type I toxin DqlB -
C4M77_RS28960 58987..60321 + 1335 WP_172440316 IncI1-type conjugal transfer protein TrbA trbA
C4M77_RS19445 (C4M77_19445) 60318..61436 + 1119 WP_029391999 DsbC family protein trbB
C4M77_RS19450 (C4M77_19450) 61417..63717 + 2301 WP_029392471 F-type conjugative transfer protein TrbC -

Host bacterium

ID   1818 GenBank   NZ_PSNU01000026
Plasmid name   FEX675|unnamed5 Incompatibility group   IncB/O/K/Z
Plasmid size   71576 bp Coordinate of oriT [Strand]   67023..67095 [+]
Host baterium   Escherichia coli strain FEX675

Cargo genes

Drug resistance gene   blaCMY-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -