Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101369
Name   oriT_KP4814|unnamed3 in_silico
Organism   Klebsiella pneumoniae strain KP4814
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAGGIL010000003 (149269..149296 [+], 28 nt)
oriT length   28 nt
IRs (inverted repeats)      16..21, 23..28  (ATCAGA..TCTGAT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 28 nt

>oriT_KP4814|unnamed3
AGTTTGGTGCTTATGATCAGAATCTGAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   868 GenBank   WP_004181913
Name   traD_HZF21_RS26375_KP4814|unnamed3 insolico UniProt ID   _
Length   708 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 708 a.a.        Molecular weight: 79493.94 Da        Isoelectric Point: 8.4986

>WP_004181913.1 MULTISPECIES: conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MKRRSRNNLHTQEMLYRPALEFRSALILILFSAYVLIDSWTSKYGISEIPFYCSLGLIAMAGWRVWHGVP
VFIAHWRLFHRTMDFLSLEDFRMINNAHFFADDRKYQKLVSLQESGGAPSKKSVYQLLRKKEKIVIPQRT
TFLCNGFKWGPEHSERTYQVHNLSSDMHEVQLPFILNPVTRHYRKLAFDLGGNYAIFGVDKKIPIFVNEE
NFFGHTLITGNVGTGKTVLQRLLSSSMLHLGHIVLVVDPKNDYQWQEGLKEECESLGKPFMHFHAGNPST
SVSYDVSANYVKDTDLSARIMSIISGTEGGEDPFVRIAEGLVTTAIGALKLGGTKPTIQNIYYAIRSKQD
LIVTTRNALRGFYTYHLGADWHLTVQVSPNLTFADEIEKLKEYFHCNYFEDNSPKNMHGMDTVLECFKYI
SGDESHYYKITASLMPMLKRLSQTPMDILLSANDVENPDRNIVNSHGLFNSGGVLYISLDGLSDPATARD
LSQLITSDIAAEAGSRYNTASDLSTVPRVSIFIDEAHQAVNMQLINLLAQGRAAKIALFISTQTISDFVS
ATSADTADRLTGLCNNYISTRVTDAKTQELVLTKVGQTNVSMNQVTYTTSAGTKQSHTDFNGSISERKST
TMVNAIPQELLSMIPTLHFIACLQDGRKIVGQMPITVPGKSMRRSTTVFDMVTTSPYKLKMRRNLNVEEI
LSKSQKVG

  Protein domains


Predicted by InterproScan.

AAA-like domain (AAA_10)

(214-261)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(473-655)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 262172..271199

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HZF21_RS27330 (HZF21_27325) 257394..257852 - 459 WP_004196672 hypothetical protein -
HZF21_RS27335 (HZF21_27330) 258143..259263 + 1121 WP_166689837 IS3 family transposase -
HZF21_RS27340 (HZF21_27335) 259761..260564 + 804 WP_042919278 metallophosphoesterase -
HZF21_RS27345 (HZF21_27340) 260554..261270 + 717 WP_043907029 hypothetical protein -
HZF21_RS27350 (HZF21_27345) 261257..261757 + 501 WP_004196661 hypothetical protein -
HZF21_RS27355 (HZF21_27350) 261729..262145 + 417 WP_223291280 trhZ -
HZF21_RS27360 (HZF21_27355) 262172..264889 - 2718 WP_004196678 TraC family protein virb4
HZF21_RS27365 (HZF21_27360) 264934..265671 - 738 WP_208790068 type IV conjugative transfer system lipoprotein TraV traV
HZF21_RS27370 (HZF21_27365) 265681..266532 - 852 WP_025368610 disulfide isomerase -
HZF21_RS27375 (HZF21_27370) 266535..266999 - 465 WP_004181799 hypothetical protein -
HZF21_RS27380 (HZF21_27375) 267002..268372 - 1371 WP_032437928 TrbI/VirB10 family protein traB
HZF21_RS27385 (HZF21_27380) 268332..268850 - 519 WP_014386508 hypothetical protein -
HZF21_RS27390 (HZF21_27385) 268847..270016 - 1170 WP_042919274 type-F conjugative transfer system secretin TraK traK
HZF21_RS27395 (HZF21_27390) 270018..270878 - 861 WP_004196647 TraE/TraK family type IV conjugative transfer system protein traE
HZF21_RS27400 (HZF21_27395) 270897..271199 - 303 WP_024198097 type IV conjugative transfer system protein TraL traL
HZF21_RS27405 (HZF21_27400) 271301..271669 - 369 WP_004026504 hypothetical protein -
HZF21_RS27410 (HZF21_27405) 272944..273612 + 669 WP_014386506 hypothetical protein -
HZF21_RS27415 (HZF21_27410) 273668..274432 + 765 WP_004196640 hypothetical protein -
HZF21_RS27420 (HZF21_27415) 274560..275738 + 1179 WP_042919272 DNA-binding protein -
HZF21_RS28565 275780..275908 + 129 WP_004196653 hypothetical protein -

Host bacterium

ID   1813 GenBank   NZ_JAGGIL010000003
Plasmid name   KP4814|unnamed3 Incompatibility group   IncFIB
Plasmid size   318133 bp Coordinate of oriT [Strand]   149269..149296 [+]
Host baterium   Klebsiella pneumoniae strain KP4814

Cargo genes

Drug resistance gene   blaCTX-M-15, aac(6')-Ib-cr, blaOXA-1, dfrA14, tet(D), blaTEM-1A, mph(E), msr(E), armA, sul1, qacE, aadA2, dfrA12
Virulence gene   iucA, iucB, iucC, iutA
Metal resistance gene   terE, terD, terC, terB, terA, terZ, terW, merR, merT, merP, merC, merA, merD, merE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -