Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 101354 |
| Name | oriT_pIncI2  |
| Organism | Klebsiella pneumoniae strain SP4187 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_JACXCE010000024 (14164..14216 [+], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pIncI2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 862 | GenBank | WP_000338976 |
| Name | t4cp2_IEE95_RS23730_pIncI2 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73346.95 Da Isoelectric Point: 9.3476
>WP_000338976.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 33362..57049
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IEE95_RS23595 (IEE95_23515) | 29231..29683 | + | 453 | WP_000101553 | CaiF/GrlA family transcriptional regulator | - |
| IEE95_RS23600 (IEE95_23520) | 29676..29870 | + | 195 | WP_000049865 | DUF1187 family protein | - |
| IEE95_RS23605 (IEE95_23525) | 29916..30869 | + | 954 | WP_072105959 | SPFH domain-containing protein | - |
| IEE95_RS23610 (IEE95_23530) | 31249..31692 | + | 444 | WP_000964840 | NfeD family protein | - |
| IEE95_RS23615 (IEE95_23535) | 31696..31866 | + | 171 | WP_000550721 | hypothetical protein | - |
| IEE95_RS23620 (IEE95_23540) | 31877..32530 | + | 654 | WP_001542016 | hypothetical protein | - |
| IEE95_RS23625 (IEE95_23545) | 32564..32821 | + | 258 | WP_001542015 | hypothetical protein | - |
| IEE95_RS23630 (IEE95_23550) | 32802..33104 | + | 303 | WP_001360345 | hypothetical protein | - |
| IEE95_RS23635 (IEE95_23555) | 33101..33358 | + | 258 | WP_000739143 | hypothetical protein | - |
| IEE95_RS23640 (IEE95_23560) | 33362..34357 | + | 996 | WP_001028540 | type IV secretion system protein | virB6 |
| IEE95_RS23645 (IEE95_23565) | 34363..35007 | + | 645 | WP_001542014 | type IV secretion system protein | - |
| IEE95_RS23650 (IEE95_23570) | 35016..35240 | + | 225 | WP_000713562 | EexN family lipoprotein | - |
| IEE95_RS23655 (IEE95_23575) | 35463..36272 | - | 810 | WP_001005152 | DUF5710 domain-containing protein | - |
| IEE95_RS23660 (IEE95_23580) | 36491..37126 | + | 636 | WP_000843091 | hypothetical protein | - |
| IEE95_RS23665 (IEE95_23585) | 37193..37492 | + | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| IEE95_RS23670 (IEE95_23590) | 37495..38730 | + | 1236 | WP_001542012 | TcpQ domain-containing protein | - |
| IEE95_RS23675 (IEE95_23595) | 38736..39173 | + | 438 | WP_001542011 | type IV pilus biogenesis protein PilM | - |
| IEE95_RS23680 (IEE95_23600) | 39292..39690 | + | 399 | WP_001153669 | hypothetical protein | - |
| IEE95_RS23685 (IEE95_23605) | 39711..40295 | + | 585 | WP_001177117 | lytic transglycosylase domain-containing protein | virB1 |
| IEE95_RS23690 | 40295..40585 | + | 291 | WP_000865479 | conjugal transfer protein | - |
| IEE95_RS23695 (IEE95_23615) | 40656..40976 | + | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| IEE95_RS23700 (IEE95_23620) | 40982..43339 | + | 2358 | WP_000548950 | VirB4 family type IV secretion system protein | virb4 |
| IEE95_RS23705 (IEE95_23625) | 43371..43505 | + | 135 | WP_000701233 | hypothetical protein | - |
| IEE95_RS23710 (IEE95_23630) | 43505..44239 | + | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| IEE95_RS23715 (IEE95_23635) | 44305..45006 | + | 702 | WP_049824867 | TrbG/VirB9 family P-type conjugative transfer protein | virB9 |
| IEE95_RS23720 (IEE95_23640) | 44996..46135 | + | 1140 | WP_001542008 | TrbI/VirB10 family protein | virB10 |
| IEE95_RS23725 (IEE95_23645) | 46154..47209 | + | 1056 | WP_001542006 | P-type DNA transfer ATPase VirB11 | virB11 |
| IEE95_RS23730 (IEE95_23650) | 47225..49183 | + | 1959 | WP_000338976 | type IV secretory system conjugative DNA transfer family protein | - |
| IEE95_RS23735 (IEE95_23655) | 49230..49760 | + | 531 | WP_001220542 | sigma 54-interacting transcriptional regulator | virb4 |
| IEE95_RS23740 (IEE95_23660) | 49753..51396 | + | 1644 | WP_001035590 | PilN family type IVB pilus formation outer membrane protein | - |
| IEE95_RS23745 (IEE95_23665) | 51447..52757 | + | 1311 | WP_001420476 | type 4b pilus protein PilO2 | - |
| IEE95_RS23750 (IEE95_23670) | 52741..53235 | + | 495 | WP_000912551 | type IV pilus biogenesis protein PilP | - |
| IEE95_RS23755 (IEE95_23675) | 53260..54798 | + | 1539 | WP_001420475 | ATPase, T2SS/T4P/T4SS family | virB11 |
| IEE95_RS23760 (IEE95_23680) | 54789..55898 | + | 1110 | WP_265715904 | type II secretion system F family protein | - |
| IEE95_RS23765 (IEE95_23685) | 55943..56500 | + | 558 | WP_000095051 | type 4 pilus major pilin | - |
| IEE95_RS23770 (IEE95_23690) | 56567..57049 | + | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| IEE95_RS23775 (IEE95_23695) | 57053..57688 | + | 636 | WP_000934978 | A24 family peptidase | - |
| IEE95_RS23780 (IEE95_23700) | 57701..58722 | + | 1022 | WP_000750511 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
Host bacterium
| ID | 1798 | GenBank | NZ_JACXCE010000024 |
| Plasmid name | pIncI2 | Incompatibility group | IncI2 |
| Plasmid size | 58722 bp | Coordinate of oriT [Strand] | 14164..14216 [+] |
| Host baterium | Klebsiella pneumoniae strain SP4187 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |