Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 101346 |
| Name | oriT_pD5-9891_mcr-1  |
| Organism | Salmonella sp. D5-9891 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_JADGML010000002 (18245..18297 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pD5-9891_mcr-1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 859 | GenBank | WP_015059539 |
| Name | t4cp2_IM762_RS24140_pD5-9891_mcr-1 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 37158..60615
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IM762_RS24085 (IM762_24085) | 32647..33771 | - | 1125 | WP_000486716 | site-specific integrase | - |
| IM762_RS24090 (IM762_24090) | 35262..36506 | - | 1245 | WP_112923602 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| IM762_RS24095 (IM762_24095) | 36519..37154 | - | 636 | WP_000934977 | A24 family peptidase | - |
| IM762_RS24100 (IM762_24100) | 37158..37640 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| IM762_RS24105 (IM762_24105) | 37706..38263 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| IM762_RS24110 (IM762_24110) | 38308..39417 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| IM762_RS24115 (IM762_24115) | 39408..40946 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| IM762_RS24120 (IM762_24120) | 40971..41465 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| IM762_RS24125 (IM762_24125) | 41449..42759 | - | 1311 | WP_001454111 | type 4b pilus protein PilO2 | - |
| IM762_RS24130 (IM762_24130) | 42810..44453 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| IM762_RS24135 (IM762_24135) | 44446..44982 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| IM762_RS24140 (IM762_24140) | 45029..46987 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| IM762_RS24145 (IM762_24145) | 47003..48058 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| IM762_RS24150 (IM762_24150) | 48077..49216 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| IM762_RS24155 (IM762_24155) | 49206..49907 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | virB9 |
| IM762_RS24160 (IM762_24160) | 49973..50707 | - | 735 | WP_073028581 | type IV secretion system protein | virB8 |
| IM762_RS24165 (IM762_24165) | 50707..50841 | - | 135 | WP_000701233 | hypothetical protein | - |
| IM762_RS24170 (IM762_24170) | 50873..53230 | - | 2358 | WP_063078682 | VirB4 family type IV secretion system protein | virb4 |
| IM762_RS24175 (IM762_24175) | 53236..53556 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| IM762_RS24565 | 53627..53917 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| IM762_RS24185 (IM762_24185) | 53917..54501 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| IM762_RS24190 (IM762_24190) | 54522..54920 | - | 399 | WP_072643816 | hypothetical protein | - |
| IM762_RS24195 (IM762_24195) | 55039..55476 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| IM762_RS24200 (IM762_24200) | 55482..56717 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| IM762_RS24205 (IM762_24205) | 56720..57019 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| IM762_RS24210 (IM762_24210) | 57087..57368 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| IM762_RS24215 (IM762_24215) | 57358..57609 | - | 252 | WP_000121741 | hypothetical protein | - |
| IM762_RS24220 (IM762_24220) | 57709..58344 | - | 636 | WP_015059536 | hypothetical protein | - |
| IM762_RS24225 (IM762_24225) | 58417..58704 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
| IM762_RS24230 (IM762_24230) | 58717..58971 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| IM762_RS24235 (IM762_24235) | 58973..59614 | - | 642 | WP_001425343 | type IV secretion system protein | - |
| IM762_RS24240 (IM762_24240) | 59620..60615 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| IM762_RS24245 (IM762_24245) | 60619..60876 | - | 258 | WP_000739144 | hypothetical protein | - |
| IM762_RS24250 (IM762_24250) | 60873..61175 | - | 303 | WP_001360345 | hypothetical protein | - |
| IM762_RS24255 (IM762_24255) | 61156..61413 | - | 258 | WP_001542015 | hypothetical protein | - |
| IM762_RS24260 (IM762_24260) | 61446..61892 | - | 447 | WP_001243165 | hypothetical protein | - |
| IM762_RS24265 (IM762_24265) | 61903..62073 | - | 171 | WP_000550720 | hypothetical protein | - |
| IM762_RS24270 (IM762_24270) | 62077..62520 | - | 444 | WP_000964330 | NfeD family protein | - |
| IM762_RS24275 (IM762_24275) | 62894..63847 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| IM762_RS24280 (IM762_24280) | 63874..64050 | - | 177 | WP_000753050 | hypothetical protein | - |
| IM762_RS24285 (IM762_24285) | 64043..64258 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| IM762_RS24290 (IM762_24290) | 64251..64703 | - | 453 | WP_000101552 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 1790 | GenBank | NZ_JADGML010000002 |
| Plasmid name | pD5-9891_mcr-1 | Incompatibility group | IncI2 |
| Plasmid size | 65842 bp | Coordinate of oriT [Strand] | 18245..18297 [-] |
| Host baterium | Salmonella sp. D5-9891 |
Cargo genes
| Drug resistance gene | blaCTX-M-55, mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |