Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101284
Name   oriT_22|unnamed3 in_silico
Organism   Aeromonas veronii strain 22
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAEMTZ010000185 (5160..5198 [+], 39 nt)
oriT length   39 nt
IRs (inverted repeats)      7..14, 19..26  (TACTTTGC..GCAAAGTA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 39 nt

>oriT_22|unnamed3
GGGCACTACTTTGCGTTAGCAAAGTATAGTGAGTACACT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1236 GenBank   WP_199417005
Name   mobV_JHD43_RS24510_22|unnamed3 insolico UniProt ID   _
Length   193 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 193 a.a.        Molecular weight: 21509.13 Da        Isoelectric Point: 9.7749

>WP_199417005.1 MobV family relaxase, partial [Aeromonas veronii]
MPAHFAILRTAKLKSLGNVGGSLAHTYRTRETSNADPSRADQNEHSHATPGEVMQALRDKLPEKRRKDAV
IGLEYFVGGSPEWFEGKTREQQDAYFREAVGWLEKRHGKENVVGWSIHRDESTPHLVAYVVPLDDKGKLN
AKQWTGGPAALSKMQTDFAKTVGARHGLERGIEGSKAHHQTIKDFYAQIDKPG

  Protein domains


Predicted by InterproScan.

(4-186)


  Protein structure



No available structure.




Host bacterium


ID   1728 GenBank   NZ_JAEMTZ010000185
Plasmid name   22|unnamed3 Incompatibility group   -
Plasmid size   5820 bp Coordinate of oriT [Strand]   5160..5198 [+]
Host baterium   Aeromonas veronii strain 22

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -