Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101243
Name   oriT_FWSEC0066|unnamed6 in_silico
Organism   Escherichia coli strain FWSEC0066
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RREL01000133 (10876..10928 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_FWSEC0066|unnamed6
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   826 GenBank   WP_000338972
Name   t4cp2_C9Z16_RS26000_FWSEC0066|unnamed6 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73329.86 Da        Isoelectric Point: 9.1391

>WP_000338972.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDISLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 29408..52413

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9Z16_RS25860 (C9Z16_25915) 24900..25352 + 453 WP_000101552 CaiF/GrlA family transcriptional regulator -
C9Z16_RS25865 (C9Z16_25920) 25345..25539 + 195 WP_001127358 DUF1187 family protein -
C9Z16_RS25870 (C9Z16_25925) 25585..26538 + 954 WP_072097371 SPFH domain-containing protein -
C9Z16_RS25875 (C9Z16_25930) 26600..27043 + 444 WP_000498521 NfeD family protein -
C9Z16_RS26400 27047..27217 + 171 WP_000550721 hypothetical protein -
C9Z16_RS25880 (C9Z16_25935) 27228..27890 + 663 WP_001243159 hypothetical protein -
C9Z16_RS25890 (C9Z16_25945) 28041..28634 + 594 WP_001243171 hypothetical protein -
C9Z16_RS25900 (C9Z16_25955) 28848..29150 + 303 WP_000189499 hypothetical protein -
C9Z16_RS25905 (C9Z16_25960) 29147..29404 + 258 WP_000739144 hypothetical protein -
C9Z16_RS25910 (C9Z16_25965) 29408..30403 + 996 WP_000276068 type IV secretion system protein virB6
C9Z16_RS25915 (C9Z16_25970) 30409..31050 + 642 WP_001415805 type IV secretion system protein -
C9Z16_RS25920 (C9Z16_25975) 31053..31307 + 255 WP_000609210 EexN family lipoprotein -
C9Z16_RS25925 (C9Z16_25980) 31360..32169 - 810 WP_001005154 DUF5710 domain-containing protein -
C9Z16_RS25930 (C9Z16_25985) 32217..32852 + 636 WP_000835769 hypothetical protein -
C9Z16_RS25935 (C9Z16_25990) 33024..33311 + 288 WP_001326593 TrbM/KikA/MpfK family conjugal transfer protein -
C9Z16_RS25940 (C9Z16_25995) 33314..34549 + 1236 WP_000733393 toxin co-regulated pilus biosynthesis Q family protein -
C9Z16_RS25945 (C9Z16_26000) 34555..34992 + 438 WP_000539665 type IV pilus biogenesis protein PilM -
C9Z16_RS25950 (C9Z16_26005) 35111..35509 + 399 WP_001153669 hypothetical protein -
C9Z16_RS25955 (C9Z16_26010) 35530..36114 + 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
C9Z16_RS26490 36114..36404 + 291 WP_000865478 TrbC/VirB2 family protein virB2
C9Z16_RS25965 (C9Z16_26020) 36475..36795 + 321 WP_000362083 VirB3 family type IV secretion system protein virB3
C9Z16_RS25970 (C9Z16_26025) 36801..39158 + 2358 WP_000548951 VirB4 family type IV secretion system protein virb4
C9Z16_RS25980 (C9Z16_26035) 39324..40058 + 735 WP_000432283 type IV secretion system protein virB8
C9Z16_RS25985 (C9Z16_26040) 40124..40825 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
C9Z16_RS25990 (C9Z16_26045) 40815..41954 + 1140 WP_000790639 TrbI/VirB10 family protein virB10
C9Z16_RS25995 (C9Z16_26050) 42037..43092 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
C9Z16_RS26000 (C9Z16_26055) 43108..45066 + 1959 WP_000338972 type IV secretory system conjugative DNA transfer family protein -
C9Z16_RS26005 (C9Z16_26060) 45117..46760 + 1644 WP_001035589 PilN family type IVB pilus formation outer membrane protein -
C9Z16_RS26010 (C9Z16_26065) 46811..48121 + 1311 WP_001454111 type 4b pilus protein PilO2 -
C9Z16_RS26015 (C9Z16_26070) 48105..48599 + 495 WP_000912554 type IV pilus biogenesis protein PilP -
C9Z16_RS26020 (C9Z16_26075) 48624..50162 + 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
C9Z16_RS26025 (C9Z16_26080) 50153..51262 + 1110 WP_000974903 type II secretion system F family protein -
C9Z16_RS26030 (C9Z16_26085) 51307..51864 + 558 WP_000095048 type 4 pilus major pilin -
C9Z16_RS26035 (C9Z16_26090) 51931..52413 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
C9Z16_RS26040 (C9Z16_26095) 52417..53052 + 636 WP_000934978 A24 family peptidase -
C9Z16_RS26045 (C9Z16_26100) 53065..54441 + 1377 WP_000750519 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
C9Z16_RS27305 (C9Z16_26105) 54438..54659 - 222 Protein_68 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
C9Z16_RS26065 (C9Z16_26120) 55299..56423 + 1125 WP_000486720 site-specific integrase -
C9Z16_RS26070 (C9Z16_26125) 56435..57088 + 654 WP_000572549 hypothetical protein -


Host bacterium


ID   1687 GenBank   NZ_RREL01000133
Plasmid name   FWSEC0066|unnamed6 Incompatibility group   IncI2
Plasmid size   58087 bp Coordinate of oriT [Strand]   10876..10928 [+]
Host baterium   Escherichia coli strain FWSEC0066

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -