Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101233
Name   oriT_p56 in_silico
Organism   Escherichia coli O157:H7 strain 438/99
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAHCTZ010000004 (12818..12870 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_p56
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   819 GenBank   WP_000338972
Name   t4cp2_JKN66_RS27820_p56 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73329.86 Da        Isoelectric Point: 9.1391

>WP_000338972.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDISLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 29455..51670

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JKN66_RS27765 (JKN66_27560) 24780..25433 - 654 WP_000572550 hypothetical protein -
JKN66_RS27770 (JKN66_27565) 25445..26569 - 1125 WP_000486720 site-specific integrase -
JKN66_RS28720 (JKN66_27570) 26982..27203 - 222 Protein_37 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
JKN66_RS27775 (JKN66_27575) 27517..28803 - 1287 WP_015057162 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
JKN66_RS27780 (JKN66_27580) 28816..29451 - 636 WP_000934978 A24 family peptidase -
JKN66_RS27785 (JKN66_27585) 29455..29937 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
JKN66_RS27790 (JKN66_27590) 30004..30561 - 558 WP_000095048 type 4 pilus major pilin -
JKN66_RS27795 (JKN66_27595) 30606..31715 - 1110 WP_226280623 type II secretion system F family protein -
JKN66_RS27800 (JKN66_27600) 31706..33244 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
JKN66_RS27805 (JKN66_27605) 33269..33763 - 495 WP_000912554 type IV pilus biogenesis protein PilP -
JKN66_RS27810 (JKN66_27610) 33747..35057 - 1311 WP_001454111 type 4b pilus protein PilO2 -
JKN66_RS27815 (JKN66_27615) 35108..36751 - 1644 WP_001035589 PilN family type IVB pilus formation outer membrane protein -
JKN66_RS27820 (JKN66_27620) 36802..38760 - 1959 WP_000338972 type IV secretory system conjugative DNA transfer family protein -
JKN66_RS27825 (JKN66_27625) 38776..39831 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
JKN66_RS27830 (JKN66_27630) 39882..41021 - 1140 WP_000790639 TrbI/VirB10 family protein virB10
JKN66_RS27835 (JKN66_27635) 41011..41712 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein virB9
JKN66_RS27840 (JKN66_27640) 41778..42512 - 735 WP_000432283 type IV secretion system protein virB8
JKN66_RS27845 (JKN66_27645) 42678..45035 - 2358 WP_000548951 VirB4 family type IV secretion system protein virb4
JKN66_RS27850 (JKN66_27650) 45041..45361 - 321 WP_000362083 VirB3 family type IV secretion system protein virB3
JKN66_RS27855 (JKN66_27655) 45432..45722 - 291 WP_000865478 TrbC/VirB2 family protein virB2
JKN66_RS27860 (JKN66_27660) 45722..46306 - 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
JKN66_RS27865 (JKN66_27665) 46327..46725 - 399 WP_001153669 hypothetical protein -
JKN66_RS27870 (JKN66_27670) 46844..47281 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
JKN66_RS27875 (JKN66_27675) 47287..48522 - 1236 WP_000733393 toxin co-regulated pilus biosynthesis Q family protein -
JKN66_RS27880 (JKN66_27680) 48525..48812 - 288 WP_001326593 TrbM/KikA/MpfK family conjugal transfer protein -
JKN66_RS27885 (JKN66_27685) 48984..49619 - 636 WP_022645136 hypothetical protein -
JKN66_RS27890 (JKN66_27690) 49772..50026 - 255 WP_001043555 EexN family lipoprotein -
JKN66_RS27895 (JKN66_27695) 50028..50669 - 642 WP_001463086 type IV secretion system protein -
JKN66_RS27900 (JKN66_27700) 50675..51670 - 996 WP_001028543 type IV secretion system protein virB6
JKN66_RS27905 (JKN66_27705) 51674..51931 - 258 WP_032213114 hypothetical protein -
JKN66_RS27910 (JKN66_27710) 51928..52230 - 303 WP_001360345 hypothetical protein -
JKN66_RS27915 (JKN66_27715) 52211..52468 - 258 WP_001542015 hypothetical protein -
JKN66_RS27920 (JKN66_27720) 52502..53155 - 654 WP_044069354 hypothetical protein -
JKN66_RS27925 (JKN66_27725) 53166..53336 - 171 WP_044069355 hypothetical protein -
JKN66_RS27930 (JKN66_27730) 53340..53783 - 444 WP_072019033 NfeD family protein -
JKN66_RS27935 (JKN66_27735) 54163..55116 - 954 WP_072097371 SPFH domain-containing protein -
JKN66_RS27940 (JKN66_27740) 55162..55356 - 195 WP_001127358 DUF1187 family protein -
JKN66_RS27945 (JKN66_27745) 55349..55801 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   1677 GenBank   NZ_JAHCTZ010000004
Plasmid name   p56 Incompatibility group   IncI2
Plasmid size   56932 bp Coordinate of oriT [Strand]   12818..12870 [-]
Host baterium   Escherichia coli O157:H7 strain 438/99

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -