Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101135
Name   oriT_16-196|unnamed2 in_silico
Organism   Enterococcus faecalis strain 16-196
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_PHLE01000004 (114..139 [+], 26 nt)
oriT length   26 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 26 nt

>oriT_16-196|unnamed2
AAGTCTAGTGGGTTATACTTTACATG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1139 GenBank   WP_105461297
Name   Mob_Pre_CWC55_RS13825_16-196|unnamed2 insolico UniProt ID   _
Length   264 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 264 a.a.        Molecular weight: 31723.83 Da        Isoelectric Point: 8.6151

>WP_105461297.1 plasmid recombination protein [Enterococcus faecalis]
MSFAVARMQKVKSGNLVGVGNHNQRNTDNHSNKDIDVERSHLNYDLVNRTENYKRDIEQFINDNKSSSRA
VRKDAVLINEWIITSDNPFFKDKDDKEIDDLSDYYAMTDKAVKKTIFYGRNGKPETKYFGVRDSNRFIRI
YNKKQERKDNADVEVMSEHLWRVEIELKRDMVDYWNDCFNDLHILKPDWTSPEKLNEQAMVYMLIHEEGK
WGELNKRTKYKYKKIIKEISPIDLTDLMKSTLKANEKQLQKQIDFWQREFRFWE

  Protein domains


Predicted by InterproScan.

Plasmid recombination enzyme (Mob_Pre)

(1-100)

Replication initiation factor (Rep_trans)

(118-175)


  Protein structure



No available structure.




Host bacterium

ID   1579 GenBank   NZ_PHLE01000004
Plasmid name   16-196|unnamed2 Incompatibility group   -
Plasmid size   1979 bp Coordinate of oriT [Strand]   114..139 [+]
Host baterium   Enterococcus faecalis strain 16-196

Cargo genes

Drug resistance gene   str
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -