Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101122
Name   oriT_p3127-6 in_silico
Organism   Klebsiella pneumoniae strain FK3127
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAOVSI010000006 (21748..21775 [-], 28 nt)
oriT length   28 nt
IRs (inverted repeats)      16..21, 23..28  (ATCAGA..TCTGAT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 28 nt

>oriT_p3127-6
AGTTTGGTGCTTATGATCAGAATCTGAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   697 GenBank   WP_032438003
Name   traD_OCJ33_RS27070_p3127-6 insolico UniProt ID   _
Length   708 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 708 a.a.        Molecular weight: 79542.03 Da        Isoelectric Point: 8.6444

>WP_032438003.1 MULTISPECIES: conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MKRRSRNNLHTQEMLYRPALEFRSALILILFSAYVLIDSWTSKYGISEIPFYCSLGLIAMAGWRVWHGVP
VFIAHWRLFHRTMDFLSLEDFRMINNAHFFADDRKYQKLVSLQESGGAPSKKSVYKLLRKKEKIVIPQRT
TFLCNGFKWGPEHSERTYQVHNLSSDMHEVQLPFILNPVTRHYRKLAFDLGGNYAIFGVDKKIPIFVNEE
NFFGHTLITGNVGTGKTVLQRLLSSSMLHLGHIVLVVDPKNDYQWQEGLKEECESLGKPFMHFHAGNPST
SVSYDVSANYVKDTDLSARIMSIISGTEGGEDPFVRIAEGLVTTAIGALKLGGTKPTIQNIYYAIRSKQD
LFVTTRNALRGFYTYHLGADWHLTVQVSPNLTFADEIEKLKEYFHCNYFEDNSPKNMHGMDTVLECFKYI
SGDESHYYKITASLMPMLKRLSQTPMDILLSANDVENPERNIVNSHGLFNSGGVLYISLDGLSDPATARD
LSQLITSDIAAEAGSRYNTASDLSTVPRVSIFIDEAHQAVNMQLINLLAQGRAAKIALFISTQTISDFVS
ATSADTADRLTGLCNNYISTRVTDAKTQELVLTKVGQTNVSMNQVTYTTSAGTKQSHTDFNGSISERKST
TMVNAIPQELLSMIPTLHFIACLQDGRKIVGQMPITVPGKSMRRSTTVFDMVTTSPYKLKMRRNLNVEEI
LSKSQKVG

  Protein domains


Predicted by InterproScan.

AAA-like domain (AAA_10)

(214-261)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(473-655)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 171056..195147

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCJ33_RS27385 (OCJ33_27385) 166347..166493 - 147 WP_159178700 hypothetical protein -
OCJ33_RS27390 (OCJ33_27390) 166517..167695 - 1179 WP_004196657 hypothetical protein -
OCJ33_RS27395 (OCJ33_27395) 167823..168587 - 765 WP_070083074 hypothetical protein -
OCJ33_RS27400 (OCJ33_27400) 168643..169311 - 669 WP_014386506 hypothetical protein -
OCJ33_RS27405 (OCJ33_27405) 169456..169770 - 315 WP_032437932 hypothetical protein -
OCJ33_RS27410 (OCJ33_27410) 170586..170954 + 369 WP_004026504 hypothetical protein -
OCJ33_RS27415 (OCJ33_27415) 171056..171358 + 303 WP_024198097 type IV conjugative transfer system protein TraL traL
OCJ33_RS27420 (OCJ33_27420) 171377..172237 + 861 WP_004196647 TraE/TraK family type IV conjugative transfer system protein traE
OCJ33_RS27425 (OCJ33_27425) 172239..173408 + 1170 WP_004026506 type-F conjugative transfer system secretin TraK traK
OCJ33_RS27430 (OCJ33_27430) 173405..173923 + 519 WP_014386508 hypothetical protein -
OCJ33_RS27435 (OCJ33_27435) 173883..175253 + 1371 WP_032437928 TrbI/VirB10 family protein traB
OCJ33_RS27440 (OCJ33_27440) 175256..175720 + 465 WP_004181799 hypothetical protein -
OCJ33_RS27445 (OCJ33_27445) 175723..176574 + 852 WP_025368610 disulfide isomerase -
OCJ33_RS27450 (OCJ33_27450) 176584..177321 + 738 WP_004181797 type IV conjugative transfer system lipoprotein TraV traV
OCJ33_RS27455 (OCJ33_27455) 177366..180083 + 2718 WP_004196678 TraC family protein virb4
OCJ33_RS27460 (OCJ33_27460) 180110..180526 - 417 WP_014386510 hypothetical protein -
OCJ33_RS27465 (OCJ33_27465) 180498..180998 - 501 WP_004196661 hypothetical protein -
OCJ33_RS27470 (OCJ33_27470) 180985..181701 - 717 WP_101992390 hypothetical protein -
OCJ33_RS27475 (OCJ33_27475) 181691..182494 - 804 WP_014386512 metallophosphoesterase -
OCJ33_RS27480 (OCJ33_27480) 183178..183636 + 459 WP_004196672 hypothetical protein -
OCJ33_RS27485 (OCJ33_27485) 183611..184015 + 405 WP_032437918 hypothetical protein -
OCJ33_RS27490 (OCJ33_27490) 184003..184539 + 537 WP_004181791 hypothetical protein -
OCJ33_RS27495 (OCJ33_27495) 184667..188908 + 4242 WP_151437097 Ig-like domain-containing protein -
OCJ33_RS27500 (OCJ33_27500) 189046..189570 + 525 WP_004026522 signal peptidase I -
OCJ33_RS27505 (OCJ33_27505) 189557..190918 + 1362 WP_070083076 TrbC family F-type conjugative pilus assembly protein traW
OCJ33_RS27510 (OCJ33_27510) 190915..191952 + 1038 WP_004026524 IncHI-type conjugal transfer protein TrhU traU
OCJ33_RS27515 (OCJ33_27515) 191962..195147 + 3186 WP_070083078 conjugal transfer protein TraN traN
OCJ33_RS27520 (OCJ33_27520) 195196..196044 - 849 WP_064794295 hypothetical protein -
OCJ33_RS29195 196550..197626 + 1077 Protein_197 conjugal transfer protein TraG N-terminal domain-containing protein -

Host bacterium

ID   1566 GenBank   NZ_JAOVSI010000006
Plasmid name   p3127-6 Incompatibility group   IncFIB
Plasmid size   197626 bp Coordinate of oriT [Strand]   21748..21775 [-]
Host baterium   Klebsiella pneumoniae strain FK3127

Cargo genes

Drug resistance gene   -
Virulence gene   iutA, iucC, iucB, iucA
Metal resistance gene   terW, terZ, terA, terB, terC, terD, terE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -