Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101101
Name   oriT_pZJ3955 in_silico
Organism   Escherichia coli strain ZJ3955
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MCDN01000050 (43968..44020 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pZJ3955
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   680 GenBank   WP_241227969
Name   t4cp2_BEC86_RS19430_pZJ3955 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73403.08 Da        Isoelectric Point: 9.5763

>WP_241227969.1 type IV secretory system conjugative DNA transfer family protein [Escherichia coli]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQKVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1687..25839

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BEC86_RS19380 (BEC86_24385) 1..1035 - 1035 WP_000750512 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BEC86_RS19385 (BEC86_24390) 1048..1683 - 636 WP_069684560 A24 family peptidase -
BEC86_RS19390 (BEC86_24395) 1687..2169 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
BEC86_RS19395 (BEC86_24400) 2235..2792 - 558 WP_000095048 type 4 pilus major pilin -
BEC86_RS19400 (BEC86_24405) 2837..3946 - 1110 WP_000974903 type II secretion system F family protein -
BEC86_RS19405 (BEC86_24410) 3937..5475 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
BEC86_RS19410 (BEC86_24415) 5500..5994 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
BEC86_RS19415 (BEC86_24420) 5978..7288 - 1311 WP_001454111 type 4b pilus protein PilO2 -
BEC86_RS19420 (BEC86_24425) 7339..8982 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
BEC86_RS19425 (BEC86_24430) 8975..9505 - 531 WP_001220542 sigma 54-interacting transcriptional regulator virb4
BEC86_RS19430 (BEC86_24435) 9552..11510 - 1959 WP_241227969 type IV secretory system conjugative DNA transfer family protein -
BEC86_RS19435 (BEC86_24440) 11526..12581 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
BEC86_RS19440 (BEC86_24445) 12600..13739 - 1140 WP_000790640 TrbI/VirB10 family protein virB10
BEC86_RS19445 (BEC86_24450) 13729..14430 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
BEC86_RS19450 (BEC86_24455) 14496..15230 - 735 WP_000432282 type IV secretion system protein virB8
BEC86_RS19455 (BEC86_24465) 15396..17753 - 2358 WP_063078682 VirB4 family type IV secretion system protein virb4
BEC86_RS19460 (BEC86_24470) 17759..18079 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
BEC86_RS19465 (BEC86_24475) 18150..18440 - 291 WP_000865479 conjugal transfer protein -
BEC86_RS19470 (BEC86_24480) 18440..19024 - 585 WP_001177113 lytic transglycosylase domain-containing protein virB1
BEC86_RS19475 (BEC86_24485) 19045..19443 - 399 WP_001153665 hypothetical protein -
BEC86_RS19480 (BEC86_24490) 19562..19999 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
BEC86_RS19485 (BEC86_24495) 20005..21240 - 1236 WP_015059538 TcpQ domain-containing protein -
BEC86_RS19490 (BEC86_24500) 21243..21542 - 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
BEC86_RS19495 (BEC86_24505) 21610..21891 - 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
BEC86_RS19500 (BEC86_24510) 21881..22132 - 252 WP_000121741 hypothetical protein -
BEC86_RS19505 (BEC86_24515) 22232..22867 - 636 WP_015059536 hypothetical protein -
BEC86_RS19510 (BEC86_24520) 22915..23706 + 792 WP_023154636 DUF5710 domain-containing protein -
BEC86_RS19515 (BEC86_24525) 23961..24185 - 225 WP_000713561 EexN family lipoprotein -
BEC86_RS19520 (BEC86_24530) 24194..24838 - 645 WP_001310442 type IV secretion system protein -
BEC86_RS19525 (BEC86_24535) 24844..25839 - 996 WP_001028541 type IV secretion system protein virB6
BEC86_RS19530 (BEC86_24540) 25843..26100 - 258 WP_000739144 hypothetical protein -
BEC86_RS19535 26097..26399 - 303 WP_001360345 hypothetical protein -
BEC86_RS19540 (BEC86_24550) 26670..26882 - 213 WP_039022940 hypothetical protein -
BEC86_RS19545 26893..27063 - 171 WP_000550720 hypothetical protein -
BEC86_RS19550 27067..27510 - 444 WP_072037179 NfeD family protein -
BEC86_RS19555 (BEC86_24560) 27884..28837 - 954 WP_072109880 SPFH domain-containing protein -
BEC86_RS19560 28864..29040 - 177 WP_000753050 hypothetical protein -
BEC86_RS19565 (BEC86_24565) 29033..29248 - 216 WP_001127357 DUF1187 family protein -
BEC86_RS19570 (BEC86_24570) 29241..29693 - 453 WP_223666486 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   1545 GenBank   NZ_MCDN01000050
Plasmid name   pZJ3955 Incompatibility group   IncI2
Plasmid size   59576 bp Coordinate of oriT [Strand]   43968..44020 [-]
Host baterium   Escherichia coli strain ZJ3955

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -