Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101090
Name   oriT_pZJ71 in_silico
Organism   Escherichia coli strain ZJ71
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MCAM01000040 (43507..43559 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pZJ71
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   673 GenBank   WP_015059539
Name   t4cp2_BED25_RS22345_pZJ71 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1687..25144

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BED25_RS22295 (BED25_24280) 1..1035 - 1035 WP_000750512 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BED25_RS22300 (BED25_24285) 1048..1683 - 636 WP_000934977 A24 family peptidase -
BED25_RS22305 (BED25_24290) 1687..2169 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
BED25_RS22310 (BED25_24295) 2235..2792 - 558 WP_000095048 type 4 pilus major pilin -
BED25_RS22315 (BED25_24300) 2837..3946 - 1110 WP_000974903 type II secretion system F family protein -
BED25_RS22320 (BED25_24305) 3937..5475 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
BED25_RS22325 (BED25_24310) 5500..5994 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
BED25_RS22330 (BED25_24315) 5978..7288 - 1311 WP_001454111 type 4b pilus protein PilO2 -
BED25_RS22335 (BED25_24320) 7339..8982 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
BED25_RS22340 (BED25_24325) 8975..9511 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
BED25_RS22345 (BED25_24330) 9558..11516 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
BED25_RS22350 (BED25_24335) 11532..12587 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
BED25_RS22355 (BED25_24340) 12606..13745 - 1140 WP_171264649 TrbI/VirB10 family protein virB10
BED25_RS22360 (BED25_24345) 13735..14436 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
BED25_RS22365 (BED25_24350) 14502..15236 - 735 WP_000432282 type IV secretion system protein virB8
BED25_RS22370 (BED25_24360) 15402..17759 - 2358 WP_063078682 VirB4 family type IV secretion system protein virb4
BED25_RS22375 (BED25_24365) 17765..18085 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
BED25_RS22380 (BED25_24370) 18156..18446 - 291 WP_000865479 conjugal transfer protein -
BED25_RS22385 (BED25_24375) 18446..19030 - 585 WP_001177113 lytic transglycosylase domain-containing protein virB1
BED25_RS22390 (BED25_24380) 19051..19449 - 399 WP_001153665 hypothetical protein -
BED25_RS22395 (BED25_24385) 19568..20005 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
BED25_RS22400 (BED25_24390) 20011..21246 - 1236 WP_015059538 TcpQ domain-containing protein -
BED25_RS22405 (BED25_24395) 21249..21548 - 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
BED25_RS22410 (BED25_24400) 21616..21897 - 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
BED25_RS22415 (BED25_24405) 21887..22138 - 252 WP_000121741 hypothetical protein -
BED25_RS22420 (BED25_24410) 22238..22873 - 636 WP_015059536 hypothetical protein -
BED25_RS22425 (BED25_24415) 22946..23233 - 288 WP_001032611 EexN family lipoprotein -
BED25_RS22430 (BED25_24420) 23246..23500 - 255 WP_001043555 EexN family lipoprotein -
BED25_RS22435 (BED25_24425) 23502..24143 - 642 WP_001425343 type IV secretion system protein -
BED25_RS22440 (BED25_24430) 24149..25144 - 996 WP_001028543 type IV secretion system protein virB6
BED25_RS22445 (BED25_24435) 25148..25405 - 258 WP_000739144 hypothetical protein -
BED25_RS22450 25402..25704 - 303 WP_001360345 hypothetical protein -
BED25_RS22455 (BED25_24440) 25685..25942 - 258 WP_001542015 hypothetical protein -
BED25_RS22460 (BED25_24445) 25975..26421 - 447 WP_001243165 hypothetical protein -
BED25_RS22465 26432..26602 - 171 WP_000550720 hypothetical protein -
BED25_RS22470 26606..27049 - 444 WP_000964330 NfeD family protein -
BED25_RS22475 (BED25_24455) 27423..28376 - 954 WP_072089442 SPFH domain-containing protein -
BED25_RS22480 28403..28579 - 177 WP_000753050 hypothetical protein -
BED25_RS22485 (BED25_24460) 28572..28787 - 216 WP_001127357 DUF1187 family protein -
BED25_RS22490 (BED25_24465) 28780..29232 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   1534 GenBank   NZ_MCAM01000040
Plasmid name   pZJ71 Incompatibility group   IncI2
Plasmid size   58964 bp Coordinate of oriT [Strand]   43507..43559 [-]
Host baterium   Escherichia coli strain ZJ71

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -