Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101088
Name   oriT_pZJ48 in_silico
Organism   Escherichia coli strain ZJ48
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MCCH01000040 (43467..43519 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pZJ48
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   671 GenBank   WP_015059539
Name   t4cp2_BEC52_RS17170_pZJ48 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1687..24517

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BEC52_RS17120 (BEC52_26230) 1..1035 - 1035 WP_000750512 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BEC52_RS17125 (BEC52_26235) 1048..1683 - 636 WP_000934977 A24 family peptidase -
BEC52_RS17130 (BEC52_26240) 1687..2169 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
BEC52_RS17135 (BEC52_26245) 2235..2798 - 564 WP_034169414 type 4 pilus major pilin -
BEC52_RS17140 (BEC52_26250) 2848..3957 - 1110 WP_000974903 type II secretion system F family protein -
BEC52_RS17145 (BEC52_26255) 3948..5486 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
BEC52_RS17150 (BEC52_26260) 5511..6005 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
BEC52_RS17155 (BEC52_26265) 5989..7299 - 1311 WP_001454111 type 4b pilus protein PilO2 -
BEC52_RS17160 (BEC52_26270) 7350..8993 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
BEC52_RS17165 (BEC52_26275) 8986..9522 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
BEC52_RS17170 (BEC52_26280) 9569..11527 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
BEC52_RS17175 (BEC52_26285) 11543..12598 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
BEC52_RS17180 (BEC52_26290) 12617..13756 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
BEC52_RS17185 (BEC52_26295) 13746..14447 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
BEC52_RS17190 (BEC52_26300) 14513..15247 - 735 WP_000432282 type IV secretion system protein virB8
BEC52_RS17195 (BEC52_26310) 15413..17770 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
BEC52_RS17200 (BEC52_26315) 17776..18096 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
BEC52_RS17205 (BEC52_26320) 18167..18457 - 291 WP_000865479 conjugal transfer protein -
BEC52_RS17210 (BEC52_26325) 18457..19041 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
BEC52_RS17215 (BEC52_26330) 19062..19460 - 399 WP_001153669 hypothetical protein -
BEC52_RS17220 (BEC52_26335) 19579..20016 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
BEC52_RS17225 (BEC52_26340) 20022..21257 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
BEC52_RS17230 (BEC52_26345) 21260..21559 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
BEC52_RS17235 (BEC52_26350) 21607..22416 + 810 WP_024237698 DUF5710 domain-containing protein -
BEC52_RS17240 (BEC52_26355) 22639..22863 - 225 WP_000713562 EexN family lipoprotein -
BEC52_RS17245 (BEC52_26360) 22872..23516 - 645 WP_001310442 type IV secretion system protein -
BEC52_RS17250 (BEC52_26365) 23522..24517 - 996 WP_001028540 type IV secretion system protein virB6
BEC52_RS17255 (BEC52_26370) 24521..24778 - 258 WP_000739144 hypothetical protein -
BEC52_RS17260 24775..25077 - 303 WP_001360345 hypothetical protein -
BEC52_RS17265 (BEC52_26375) 25058..25315 - 258 WP_001542015 hypothetical protein -
BEC52_RS17270 (BEC52_26380) 25348..25794 - 447 WP_001243165 hypothetical protein -
BEC52_RS17275 25805..25975 - 171 WP_000550720 hypothetical protein -
BEC52_RS17280 25979..26422 - 444 WP_000964330 NfeD family protein -
BEC52_RS17285 (BEC52_26390) 26796..27749 - 954 WP_072089442 SPFH domain-containing protein -
BEC52_RS17290 27776..27952 - 177 WP_000753050 hypothetical protein -
BEC52_RS17295 (BEC52_26395) 27945..28160 - 216 WP_001127357 DUF1187 family protein -
BEC52_RS17300 (BEC52_26400) 28153..28605 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   1532 GenBank   NZ_MCCH01000040
Plasmid name   pZJ48 Incompatibility group   IncI2
Plasmid size   59072 bp Coordinate of oriT [Strand]   43467..43519 [-]
Host baterium   Escherichia coli strain ZJ48

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -