Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101086
Name   oriT_pZJ49 in_silico
Organism   Escherichia coli strain ZJ49
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MCCY01000048 (16405..16457 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pZJ49
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   670 GenBank   WP_015059539
Name   t4cp2_BEC70_RS23685_pZJ49 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 35407..58237

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BEC70_RS23555 (BEC70_26705) 31319..31771 + 453 WP_000101552 CaiF/GrlA family transcriptional regulator -
BEC70_RS23560 (BEC70_26710) 31764..31979 + 216 WP_001127357 DUF1187 family protein -
BEC70_RS23565 31972..32148 + 177 WP_000753050 hypothetical protein -
BEC70_RS23570 (BEC70_26715) 32175..33128 + 954 WP_072089442 SPFH domain-containing protein -
BEC70_RS23575 33502..33945 + 444 WP_000964330 NfeD family protein -
BEC70_RS23580 33949..34119 + 171 WP_000550720 hypothetical protein -
BEC70_RS23585 (BEC70_26725) 34130..34576 + 447 WP_001243165 hypothetical protein -
BEC70_RS23590 (BEC70_26730) 34609..34866 + 258 WP_001542015 hypothetical protein -
BEC70_RS23595 34847..35149 + 303 WP_001360345 hypothetical protein -
BEC70_RS23600 (BEC70_26735) 35146..35403 + 258 WP_000739144 hypothetical protein -
BEC70_RS23605 (BEC70_26740) 35407..36402 + 996 WP_001028540 type IV secretion system protein virB6
BEC70_RS23610 (BEC70_26745) 36408..37052 + 645 WP_001310442 type IV secretion system protein -
BEC70_RS23615 (BEC70_26750) 37061..37285 + 225 WP_000713562 EexN family lipoprotein -
BEC70_RS23620 (BEC70_26755) 37508..38317 - 810 WP_024237698 DUF5710 domain-containing protein -
BEC70_RS23625 (BEC70_26760) 38365..38664 + 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
BEC70_RS23630 (BEC70_26765) 38667..39902 + 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
BEC70_RS23635 (BEC70_26770) 39908..40345 + 438 WP_034169416 type IV pilus biogenesis protein PilM -
BEC70_RS23640 (BEC70_26775) 40464..40862 + 399 WP_001153669 hypothetical protein -
BEC70_RS23645 (BEC70_26780) 40883..41467 + 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
BEC70_RS23650 (BEC70_26785) 41467..41757 + 291 WP_000865479 conjugal transfer protein -
BEC70_RS23655 (BEC70_26790) 41828..42148 + 321 WP_000362080 VirB3 family type IV secretion system protein virB3
BEC70_RS23660 (BEC70_26795) 42154..44511 + 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
BEC70_RS23665 (BEC70_26805) 44677..45411 + 735 WP_000432282 type IV secretion system protein virB8
BEC70_RS23670 (BEC70_26810) 45477..46178 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
BEC70_RS23675 (BEC70_26815) 46168..47307 + 1140 WP_034169415 TrbI/VirB10 family protein virB10
BEC70_RS23680 (BEC70_26820) 47326..48381 + 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
BEC70_RS23685 (BEC70_26825) 48397..50355 + 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
BEC70_RS23690 (BEC70_26830) 50402..50938 + 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
BEC70_RS23695 (BEC70_26835) 50931..52574 + 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
BEC70_RS23700 (BEC70_26840) 52625..53935 + 1311 WP_001454111 type 4b pilus protein PilO2 -
BEC70_RS23705 (BEC70_26845) 53919..54413 + 495 WP_000912553 type IV pilus biogenesis protein PilP -
BEC70_RS23710 (BEC70_26850) 54438..55976 + 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
BEC70_RS23715 (BEC70_26855) 55967..57076 + 1110 WP_000974903 type II secretion system F family protein -
BEC70_RS23720 (BEC70_26860) 57126..57689 + 564 WP_034169414 type 4 pilus major pilin -
BEC70_RS23725 (BEC70_26865) 57755..58237 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
BEC70_RS23730 (BEC70_26870) 58241..58876 + 636 WP_000934977 A24 family peptidase -
BEC70_RS23735 (BEC70_26875) 58889..59923 + 1035 WP_000750512 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -


Host bacterium


ID   1530 GenBank   NZ_MCCY01000048
Plasmid name   pZJ49 Incompatibility group   IncI2
Plasmid size   59923 bp Coordinate of oriT [Strand]   16405..16457 [+]
Host baterium   Escherichia coli strain ZJ49

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -