Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101058
Name   oriT_pIncI2 in_silico
Organism   Escherichia coli strain PH-2670-18
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_WLVN01000011 (13731..13783 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pIncI2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   653 GenBank   WP_015059539
Name   t4cp2_GKM64_RS24155_pIncI2 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 32911..55741

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GKM64_RS24095 (GKM64_24070) 28133..29257 - 1125 WP_000486716 site-specific integrase -
GKM64_RS24100 (GKM64_24075) 29662..29817 + 156 WP_001358489 hypothetical protein -
GKM64_RS25265 30665..30886 + 222 Protein_37 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
GKM64_RS24105 (GKM64_24080) 30883..32259 - 1377 WP_000750519 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
GKM64_RS24110 (GKM64_24085) 32272..32907 - 636 WP_000934977 A24 family peptidase -
GKM64_RS24115 (GKM64_24090) 32911..33393 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
GKM64_RS24120 (GKM64_24095) 33459..34022 - 564 WP_034169414 type 4 pilus major pilin -
GKM64_RS24125 (GKM64_24100) 34072..35181 - 1110 WP_000974903 type II secretion system F family protein -
GKM64_RS24130 (GKM64_24105) 35172..36710 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
GKM64_RS24135 (GKM64_24110) 36735..37229 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
GKM64_RS24140 (GKM64_24115) 37213..38523 - 1311 WP_001454111 type 4b pilus protein PilO2 -
GKM64_RS24145 (GKM64_24120) 38574..40217 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
GKM64_RS24150 (GKM64_24125) 40210..40746 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
GKM64_RS24155 (GKM64_24130) 40793..42751 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
GKM64_RS24160 (GKM64_24135) 42767..43822 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
GKM64_RS24165 (GKM64_24140) 43841..44980 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
GKM64_RS24170 (GKM64_24145) 44970..45671 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
GKM64_RS24175 (GKM64_24150) 45737..46471 - 735 WP_000432282 type IV secretion system protein virB8
GKM64_RS24180 (GKM64_24155) 46637..48994 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
GKM64_RS24185 (GKM64_24160) 49000..49320 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
GKM64_RS25090 49391..49681 - 291 WP_000865479 conjugal transfer protein -
GKM64_RS24195 (GKM64_24170) 49681..50265 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
GKM64_RS24200 (GKM64_24175) 50286..50684 - 399 WP_001153669 hypothetical protein -
GKM64_RS24205 (GKM64_24180) 50803..51240 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
GKM64_RS24210 (GKM64_24185) 51246..52481 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
GKM64_RS24215 (GKM64_24190) 52484..52783 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
GKM64_RS24220 (GKM64_24195) 52831..53640 + 810 WP_024237698 DUF5710 domain-containing protein -
GKM64_RS24225 (GKM64_24200) 53863..54087 - 225 WP_000713562 EexN family lipoprotein -
GKM64_RS24230 (GKM64_24205) 54096..54740 - 645 WP_001310442 type IV secretion system protein -
GKM64_RS24235 (GKM64_24210) 54746..55741 - 996 WP_001028540 type IV secretion system protein virB6
GKM64_RS24240 (GKM64_24215) 55745..56002 - 258 WP_000739144 hypothetical protein -
GKM64_RS24245 (GKM64_24220) 55999..56301 - 303 WP_001360345 hypothetical protein -
GKM64_RS24250 (GKM64_24225) 56282..56539 - 258 WP_001542015 hypothetical protein -
GKM64_RS24255 (GKM64_24230) 56572..57018 - 447 WP_001243165 hypothetical protein -
GKM64_RS24655 57029..57199 - 171 WP_000550720 hypothetical protein -
GKM64_RS24260 (GKM64_24235) 57203..57646 - 444 WP_000964330 NfeD family protein -
GKM64_RS24265 (GKM64_24240) 58020..58973 - 954 WP_072089442 SPFH domain-containing protein -
GKM64_RS24660 59000..59176 - 177 WP_000753050 hypothetical protein -
GKM64_RS24270 (GKM64_24245) 59169..59384 - 216 WP_001127357 DUF1187 family protein -
GKM64_RS24275 (GKM64_24250) 59377..59829 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   1502 GenBank   NZ_WLVN01000011
Plasmid name   pIncI2 Incompatibility group   IncI2
Plasmid size   60960 bp Coordinate of oriT [Strand]   13731..13783 [-]
Host baterium   Escherichia coli strain PH-2670-18

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -