Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 101005 |
| Name | oriT_pIGRK  |
| Organism | Klebsiella pneumoniae |
| Sequence Completeness | core |
| NCBI accession of oriT (coordinates [strand]) | NC_011405 (996..1179 [+], 184 nt) |
| oriT length | 184 nt |
| IRs (inverted repeats) | IR1: 27..40, 50..63 (AATCCCTTATTGAAATAGAA..TTCTATTCCACTAAGGGATT) IR2: 104..111, 116..123 (TTGTTGTTTCAACCC..GGGTGGAACAACAA) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note |
oriT sequence
Download Length: 184 nt
CCACCCGGATATAACAGTAGTATAAGTTGTTGTTTCAACCCGTCTTTTTGGGTGGAACAACAAGGCATTTTAGGGATAGAGCAAAGCGAAGGCCATAAAATTGCCACCCCCAACCGGGGGTCGTTGTTCGATTTGAGCGATAGCGAAAAATTGAACATAAGGGGGGAGGGTTTGGGTTTTACGG
Visualization of oriT structure (The oriT was characterized experimentally)
oriT secondary structure
Predicted by RNAfold.
Download structure file
Reference
[1] Katarzyna Paulina Nowak et al. (2021) Molecular and Functional Characterization of MobK Protein-A Novel-Type Relaxase Involved in Mobilization for Conjugational Transfer of Klebsiella pneumoniae Plasmid pIGRK. International journal of molecular sciences. 22(10):5152. [PMID:34068033]
Relaxase
| ID | 1073 | GenBank | AAS55463 |
| Name | MobK_pIGRK |
UniProt ID | Q6QGC3 |
| Length | 242 a.a. | PDB ID | |
| Note | |||
Relaxase protein sequence
Download Length: 242 a.a. Molecular weight: 27513.71 Da Isoelectric Point: 10.8061
MGNSKRNIKKLNDNFREDILDYAIAHNLKCANALAILYATGCRPDELQTGVTVNYDSKKNEIEFRIIGSK
LNRRMRRGIGVRKIKVKINNENARFFKNIVDKFIENPMSYDHKIKIESAKAFSGYITKISKKLWPRKTYH
ASAYSFRHAKATELKNSDYDKIEIAQIMGHASVRSQQSYGRKSKKSKGGFDDIADVETNVKPRGGDRLLR
FKIANKNKAAAKIADTSTPSSPPPAPVRRFKM
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q6QGC3 |
Reference
[1] Katarzyna Paulina Nowak et al. (2021) Molecular and Functional Characterization of MobK Protein-A Novel-Type Relaxase Involved in Mobilization for Conjugational Transfer of Klebsiella pneumoniae Plasmid pIGRK. International journal of molecular sciences. 22(10):5152. [PMID:34068033]
Host bacterium
| ID | 1464 | GenBank | NC_011405 |
| Plasmid name | pIGRK | Incompatibility group | - |
| Plasmid size | 2348 bp | Coordinate of oriT [Strand] | 996..1179 [+] |
| Host baterium | Klebsiella pneumoniae |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |