Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100994
Name   oriT_p2511STDY5712385-2 in_silico
Organism   Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5712385
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_LN890525 (2494..2603 [-], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GTAATTGTAATAGCGTC..GACGGTATTACAATTAC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_p2511STDY5712385-2
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGTAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTACACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1064 GenBank   WP_052971501
Name   NikB_p2511STDY5712385-2 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103896.37 Da        Isoelectric Point: 7.4198

>WP_052971501.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELNLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIAQQAHYAKDNTDPVFHYILSWQAHESPRPEQIYDSVR
HTLKSLGLGEHQYVSAVHTDTDNLHVHVAVNRVHPVTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMEGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 7963..47770

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ARA94_RS24150 (ERS394426_04904) 5679..7970 - 2292 WP_072121498 F-type conjugative transfer protein TrbC -
ARA94_RS24155 (ERS394426_04905) 7963..9033 - 1071 WP_000151579 IncI1-type conjugal transfer protein TrbB trbB
ARA94_RS24160 (ERS394426_04906) 9052..10260 - 1209 WP_001383960 IncI1-type conjugal transfer protein TrbA trbA
ARA94_RS24165 (ERS394426_04907) 10478..11464 - 987 WP_060527633 hypothetical protein -
ARA94_RS24170 12033..12185 + 153 WP_023156060 Hok/Gef family protein -
ARA94_RS24175 (ERS394426_04909) 12257..12508 - 252 WP_001291965 hypothetical protein -
ARA94_RS28080 13007..13102 + 96 WP_001303310 DinQ-like type I toxin DqlB -
ARA94_RS27580 (ERS394426_04911) 13167..13343 - 177 WP_001054901 hypothetical protein -
ARA94_RS24180 (ERS394426_04912) 13675..13884 + 210 WP_000062602 HEAT repeat domain-containing protein -
ARA94_RS24185 (ERS394426_04913) 13956..14618 - 663 WP_060527638 plasmid IncI1-type surface exclusion protein ExcA -
ARA94_RS24190 (ERS394426_04914) 14689..16857 - 2169 WP_000698368 DotA/TraY family protein traY
ARA94_RS24195 (ERS394426_04915) 16954..17538 - 585 WP_060527640 IncI1-type conjugal transfer protein TraX -
ARA94_RS24200 (ERS394426_04916) 17567..18769 - 1203 WP_001189156 IncI1-type conjugal transfer protein TraW traW
ARA94_RS26435 (ERS394426_04917) 18736..19350 - 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
ARA94_RS24205 (ERS394426_04918) 19350..22394 - 3045 WP_001024780 IncI1-type conjugal transfer protein TraU traU
ARA94_RS24210 (ERS394426_04919) 22484..23284 - 801 WP_060527642 IncI1-type conjugal transfer protein TraT traT
ARA94_RS24215 (ERS394426_04920) 23268..23456 - 189 WP_060527645 putative conjugal transfer protein TraS -
ARA94_RS24220 (ERS394426_04921) 23520..23924 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
ARA94_RS24225 (ERS394426_04922) 23975..24502 - 528 WP_001055569 conjugal transfer protein TraQ traQ
ARA94_RS24230 (ERS394426_04923) 24502..25206 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
ARA94_RS24235 (ERS394426_04924) 25206..26495 - 1290 WP_001271994 conjugal transfer protein TraO traO
ARA94_RS24240 (ERS394426_04925) 26498..27481 - 984 WP_001191879 IncI1-type conjugal transfer protein TraN traN
ARA94_RS24245 (ERS394426_04926) 27492..28184 - 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
ARA94_RS24250 (ERS394426_04927) 28181..28528 - 348 WP_001055900 conjugal transfer protein traL
ARA94_RS24255 (ERS394426_04928) 28546..32313 - 3768 WP_060527647 LPD7 domain-containing protein -
ARA94_RS24260 (ERS394426_04929) 32403..32954 - 552 WP_000014584 phospholipase D family protein -
ARA94_RS26440 (ERS394426_04930) 32969..33259 - 291 WP_001299214 hypothetical protein traK
ARA94_RS24265 (ERS394426_04931) 33256..34404 - 1149 WP_001024976 plasmid transfer ATPase TraJ virB11
ARA94_RS24270 (ERS394426_04932) 34401..35219 - 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
ARA94_RS24275 (ERS394426_04933) 35216..35674 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
ARA94_RS24280 (ERS394426_04934) 36069..36653 - 585 WP_000977520 histidine phosphatase family protein -
ARA94_RS24285 (ERS394426_04935) 36713..37915 - 1203 WP_000976357 conjugal transfer protein TraF -
ARA94_RS24290 (ERS394426_04936) 38001..38825 - 825 WP_015058912 conjugal transfer protein TraE traE
ARA94_RS24295 (ERS394426_04937) 38976..40130 - 1155 WP_001139955 site-specific integrase -
ARA94_RS28085 40170..40439 + 270 Protein_42 hypothetical protein -
ARA94_RS28090 41505..41729 + 225 Protein_43 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
ARA94_RS27960 41726..41974 - 249 WP_001349157 hypothetical protein -
ARA94_RS28095 42128..42229 - 102 Protein_45 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
ARA94_RS24300 (ERS394426_04939) 42189..43289 - 1101 Protein_46 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
ARA94_RS24305 (ERS394426_04940) 43277..43933 - 657 WP_001193551 A24 family peptidase -
ARA94_RS24310 (ERS394426_04941) 43918..44478 - 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
ARA94_RS24315 (ERS394426_04942) 44488..45102 - 615 WP_000908228 type 4 pilus major pilin -
ARA94_RS24320 (ERS394426_04943) 45119..46204 - 1086 WP_001208803 type II secretion system F family protein -
ARA94_RS24325 (ERS394426_04944) 46217..47770 - 1554 WP_000362204 ATPase, T2SS/T4P/T4SS family virB11
ARA94_RS24330 (ERS394426_04945) 47781..48233 - 453 WP_001247333 type IV pilus biogenesis protein PilP -
ARA94_RS24335 (ERS394426_04946) 48220..49515 - 1296 WP_000752776 type 4b pilus protein PilO2 -
ARA94_RS24340 (ERS394426_04947) 49508..51190 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
ARA94_RS24345 (ERS394426_04948) 51204..51641 - 438 WP_000539811 type IV pilus biogenesis protein PilM -
ARA94_RS24350 (ERS394426_04949) 51641..52708 - 1068 WP_021513968 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   1452 GenBank   NZ_LN890525
Plasmid name   p2511STDY5712385-2 Incompatibility group   IncI1
Plasmid size   84987 bp Coordinate of oriT [Strand]   2494..2603 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5712385

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -