Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100991
Name   oriT_pMKFS47-II in_silico
Organism   Lactococcus piscium MKFS47
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_LN774770 (33121..33157 [+], 37 nt)
oriT length   37 nt
IRs (inverted repeats)      1..11, 15..25  (TACGCAGAAAC..GTTACTGCGTA)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  TAAGTGC|GCCCT
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 37 nt

>oriT_pMKFS47-II
TACGCAGAAACGAAGTTACTGCGTATAAGTGCGCCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1061 GenBank   WP_047916715
Name   MobA_pMKFS47-II insolico UniProt ID   A0A0D6DZV3
Length   656 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 656 a.a.        Molecular weight: 76287.27 Da        Isoelectric Point: 9.0454

>WP_047916715.1 MobA/MobL family protein [Lactococcus piscium]
MAIFHLSMTIAKREGGKRSLIAMASYRSGEKLYSELYEKTSLYNHRLVQPEAFIMKPDFVPSEFSNREFL
WNKMELSEKSANAQLCRELNVALPIELNKDDQKLLIKEFVKDNFISDGMIADVAIHRDDENNPHAHIMLS
MREVDSEGNILNKSCRIPKLDEEGNQVYNEKGHKVTVSVKTNNWNRKTFVSEIRTDWAKKVNHYLKERNI
DQQITEKSHAELGKKELPSIHEGSYSNRLSSKGITSDLKLKNSDIQDFNAILSELDKLEKQEEILKNDKS
FTLKFEKSFSPLEKKELKNLSKELKIFINDDNIEKRISELKRWENSLIFDNKMELQTQRIMLNKVNDERE
MLLKANEVLDKQADRFFKKSYPILNTDKFSKSEIRAMVNETIFRKQLLNKDQLAEVIYNERVVEQEENKK
IFKERPFQTSRYIDTKIKQIDESISSETNPQIKEVLSVKKEKLLGIKEGLIDYVQSEVSIKFDKNVSIDT
VIEGEMLLAKSEYYKTTDFSKIEGVARFTSDEINSMLEQSKGYIGYIQSAKIPNDCQGVFFVQDSMKHLD
KLSPLAKNNLKKIVNHNAYLPERDKVELSSKLEKTENIDTEEPEKPGMNVTMFQLAKSINRLVSGNVPQK
KRNLDKLIKQTKAKENQTLQRNIPLR

  Protein domains


Predicted by InterproScan.

Nicking enzyme C-terminal middle helical domain (NES_C_h)

(288-394)

MobA/MobL family (MobA_MobL)

(18-241)


  Protein structure


Source ID Structure
AlphaFold DB A0A0D6DZV3


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 18507..41423

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LACPI_RS12395 15198..15302 + 105 WP_068876876 putative holin-like toxin -
LACPI_RS11765 (LACPI_2303) 15465..15902 - 438 WP_047916699 hypothetical protein -
LACPI_RS11770 (LACPI_2304) 16116..17606 - 1491 WP_047916700 primase C-terminal domain-containing protein -
LACPI_RS11775 (LACPI_2305) 17972..18259 - 288 WP_331709485 helix-turn-helix transcriptional regulator -
LACPI_RS11780 (LACPI_2306) 18507..19283 - 777 WP_047916702 LPXTG cell wall anchor domain-containing protein prgC
LACPI_RS11785 (LACPI_2307) 19345..19716 - 372 WP_047916703 hypothetical protein -
LACPI_RS11790 (LACPI_2308) 19743..20663 - 921 WP_047916704 hypothetical protein -
LACPI_RS11795 (LACPI_2309) 20678..21610 - 933 WP_047916705 conjugal transfer protein TrbL family protein trsL
LACPI_RS11800 (LACPI_2310) 21610..22530 - 921 WP_047916706 hypothetical protein -
LACPI_RS11805 (LACPI_2311) 22550..24208 - 1659 WP_047916707 VirD4-like conjugal transfer protein, CD1115 family virb4
LACPI_RS11810 (LACPI_2312) 24201..24632 - 432 WP_047916708 hypothetical protein -
LACPI_RS11815 (LACPI_2313) 24637..25188 - 552 WP_047916709 hypothetical protein -
LACPI_RS11820 (LACPI_2314) 25200..26174 - 975 WP_231858801 lysozyme family protein orf14
LACPI_RS11825 (LACPI_2315) 26322..27674 - 1353 WP_047916710 conjugal transfer protein TraF trsF
LACPI_RS11830 (LACPI_2316) 27688..29649 - 1962 WP_047916711 TrsE protein virb4
LACPI_RS11835 (LACPI_2317) 29660..30289 - 630 WP_047916712 hypothetical protein trsD
LACPI_RS11840 (LACPI_2318) 30305..30688 - 384 WP_047916713 hypothetical protein trsC
LACPI_RS11845 (LACPI_2319) 30708..31037 - 330 WP_047916714 CagC family type IV secretion system protein -
LACPI_RS11850 (LACPI_2320) 31054..33024 - 1971 WP_047916715 MobA/MobL family protein -
LACPI_RS11855 (LACPI_2321) 33309..33608 + 300 WP_047916716 hypothetical protein -
LACPI_RS11860 (LACPI_2322) 33611..33910 + 300 WP_047916717 hypothetical protein -
LACPI_RS11865 (LACPI_2323) 33887..34180 - 294 WP_047916718 hypothetical protein -
LACPI_RS11870 (LACPI_2324) 34196..34708 - 513 WP_047916719 molecular chaperone DnaJ -
LACPI_RS12800 34974..35132 + 159 WP_157761154 hypothetical protein -
LACPI_RS11875 (LACPI_2325) 35149..36009 - 861 WP_082095487 zeta toxin family protein -
LACPI_RS11880 (LACPI_2326) 36011..36283 - 273 WP_047916720 antitoxin -
LACPI_RS11885 (LACPI_2327) 36304..36561 - 258 WP_157761155 hypothetical protein -
LACPI_RS11890 (LACPI_2328) 36597..36806 - 210 WP_047916722 peptide-binding protein -
LACPI_RS11895 (LACPI_2329) 36911..37768 - 858 WP_047916723 ParA family protein -
LACPI_RS11900 (LACPI_2330) 37904..40048 - 2145 WP_047916724 type IA DNA topoisomerase -
LACPI_RS11905 (LACPI_2331) 40140..41423 - 1284 WP_052727810 LPXTG cell wall anchor domain-containing protein prgB
LACPI_RS11910 (LACPI_2332) 41829..42350 - 522 WP_047916725 hypothetical protein -
LACPI_RS11915 (LACPI_2333) 42361..42954 - 594 WP_047916726 recombinase family protein -
LACPI_RS11920 (LACPI_2334) 42964..43170 - 207 WP_047916727 hypothetical protein -
LACPI_RS11925 (LACPI_2335) 43328..43672 - 345 WP_047916728 hypothetical protein -
LACPI_RS11930 (LACPI_2336) 43908..44588 + 681 WP_047916692 IS6-like element ISS1N family transposase -
LACPI_RS11935 (LACPI_2337) 44814..46175 + 1362 WP_082095488 AAA family ATPase -

Host bacterium

ID   1449 GenBank   NZ_LN774770
Plasmid name   pMKFS47-II Incompatibility group   _
Plasmid size   55671 bp Coordinate of oriT [Strand]   33121..33157 [+]
Host baterium   Lactococcus piscium MKFS47

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21, AcrIIA11