Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100990
Name   oriT_pKp145/11b in_silico
Organism   Klebsiella pneumoniae strain 145
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_KX118608 (45962..46066 [+], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      18..35, 42..59  (GGTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 105 nt

>oriT_pKp145/11b
AGTACGGGACAAGATGTGGTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure



Relaxase

ID   1060 GenBank   WP_004206924
Name   PutativerelaxaseofpKp145/11b insolico UniProt ID   A0A0U3I0I2
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A0U3I0I2


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 48864..67326

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BA903_RS00325 43948..44259 + 312 WP_004187333 hypothetical protein -
BA903_RS00330 44392..44928 + 537 WP_004206920 hypothetical protein -
BA903_RS00335 45429..45794 - 366 WP_004206922 hypothetical protein -
BA903_RS00340 46070..46387 + 318 WP_004206923 plasmid mobilization protein MobA -
BA903_RS00345 46374..48353 + 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
BA903_RS00350 48367..48867 + 501 WP_004206925 DotD/TraH family lipoprotein -
BA903_RS00355 48864..49643 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BA903_RS00360 49654..50817 + 1164 WP_045342066 plasmid transfer ATPase TraJ virB11
BA903_RS34620 50807..50920 + 114 Protein_74 TraK -
BA903_RS34010 50995..52326 + 1332 WP_228149729 toprim domain-containing protein -
BA903_RS00370 52290..53663 + 1374 WP_228149730 LPD7 domain-containing protein -
BA903_RS00375 53629..54141 + 513 WP_011091071 hypothetical protein traL
BA903_RS00380 54142..54354 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
BA903_RS00385 54326..54736 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BA903_RS00390 54804..55517 + 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
BA903_RS00395 55526..56677 + 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
BA903_RS00400 56689..58038 + 1350 WP_004206932 conjugal transfer protein TraO traO
BA903_RS00405 58050..58754 + 705 WP_045342064 conjugal transfer protein TraP traP
BA903_RS00410 58778..59308 + 531 WP_004187478 conjugal transfer protein TraQ traQ
BA903_RS00415 59325..59714 + 390 WP_011154472 DUF6750 family protein traR
BA903_RS00420 59760..60254 + 495 WP_085327669 hypothetical protein -
BA903_RS00425 60251..63301 + 3051 WP_011154474 conjugative transfer protein traU
BA903_RS00430 63298..64506 + 1209 WP_004187486 conjugal transfer protein TraW traW
BA903_RS00435 64503..65153 + 651 WP_004187488 hypothetical protein -
BA903_RS00440 65146..67326 + 2181 WP_004187492 DotA/TraY family protein traY
BA903_RS00445 67329..67982 + 654 WP_086926038 ExcA -
BA903_RS00450 68056..68286 + 231 WP_004187496 IncL/M type plasmid replication protein RepC -

Host bacterium

ID   1448 GenBank   NZ_KX118608
Plasmid name   pKp145/11b Incompatibility group   IncL/M
Plasmid size   68582 bp Coordinate of oriT [Strand]   45962..46066 [+]
Host baterium   Klebsiella pneumoniae strain 145

Cargo genes

Drug resistance gene   blaTEM-1A, blaOXA-9, ant(3'')-Ia, aac(6')-Ib, qnrE1, blaCTX-M-8
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA8