Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100982
Name   oriT_p704SK10_2 in_silico
Organism   Enterobacter roggenkampii strain 704SK10
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP022150 (40154..40259 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_p704SK10_2
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1052 GenBank   WP_004187323
Name   Putativerelaxaseofp704SK10_2 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 43055..62209

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CES92_RS24750 (CES92_24755) 38139..38450 + 312 WP_004187333 hypothetical protein -
CES92_RS24755 (CES92_24760) 38583..39119 + 537 WP_004187332 hypothetical protein -
CES92_RS24760 (CES92_24765) 39621..40016 - 396 WP_019725163 hypothetical protein -
CES92_RS25655 40051..40578 + 528 WP_172740549 plasmid mobilization protein MobA -
CES92_RS24770 (CES92_24775) 40565..42544 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
CES92_RS24775 (CES92_24780) 42558..43058 + 501 WP_004187320 DotD/TraH family lipoprotein -
CES92_RS24780 (CES92_24785) 43055..43834 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
CES92_RS24785 (CES92_24790) 43845..45008 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
CES92_RS24790 (CES92_24795) 44998..45258 + 261 WP_004187310 IcmT/TraK family protein traK
CES92_RS25660 45283..48585 + 3303 WP_219724342 LPD7 domain-containing protein -
CES92_RS24800 (CES92_24805) 48551..49063 + 513 WP_011091071 hypothetical protein traL
CES92_RS24805 (CES92_24810) 49064..49276 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
CES92_RS24810 (CES92_24815) 49248..49658 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
CES92_RS24815 (CES92_24820) 49726..50439 + 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
CES92_RS24820 (CES92_24825) 50448..51599 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
CES92_RS24825 (CES92_24830) 51611..52960 + 1350 WP_004187474 conjugal transfer protein TraO traO
CES92_RS24830 (CES92_24835) 52972..53676 + 705 WP_015060002 conjugal transfer protein TraP traP
CES92_RS24835 (CES92_24840) 53700..54230 + 531 WP_004187478 conjugal transfer protein TraQ traQ
CES92_RS24840 (CES92_24845) 54247..54636 + 390 WP_004187479 DUF6750 family protein traR
CES92_RS24845 (CES92_24850) 54682..55176 + 495 WP_004187480 hypothetical protein -
CES92_RS24850 (CES92_24855) 55173..58223 + 3051 WP_004187482 hypothetical protein traU
CES92_RS24855 (CES92_24860) 58220..59428 + 1209 WP_011091082 conjugal transfer protein TraW traW
CES92_RS24860 (CES92_24865) 59425..60021 + 597 WP_015060003 hypothetical protein -
CES92_RS24865 (CES92_24870) 60014..62209 + 2196 WP_015062834 DotA/TraY family protein traY
CES92_RS24870 (CES92_24875) 62211..62864 + 654 WP_015060005 hypothetical protein -
CES92_RS24875 (CES92_24880) 62933..63175 + 243 WP_023893611 IncL/M type plasmid replication protein RepC -

Host bacterium

ID   1440 GenBank   NZ_CP022150
Plasmid name   p704SK10_2 Incompatibility group   IncL/M
Plasmid size   63458 bp Coordinate of oriT [Strand]   40154..40259 [+]
Host baterium   Enterobacter roggenkampii strain 704SK10

Cargo genes

Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -