Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100981
Name   oriT_p704SK6_4 in_silico
Organism   Klebsiella pneumoniae isolate 704SK6
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP022147 (40150..40255 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_p704SK6_4
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1051 GenBank   WP_004187323
Name   Putativerelaxaseofp704SK6_4 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 43051..62356

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CES89_RS29035 (CES89_29035) 38135..38446 + 312 WP_004187333 hypothetical protein -
CES89_RS29040 (CES89_29040) 38579..39115 + 537 WP_004187332 hypothetical protein -
CES89_RS29045 (CES89_29045) 39617..40012 - 396 WP_019725163 hypothetical protein -
CES89_RS30285 40047..40574 + 528 WP_172740549 plasmid mobilization protein MobA -
CES89_RS29055 (CES89_29055) 40561..42540 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
CES89_RS29060 (CES89_29060) 42554..43054 + 501 WP_004187320 DotD/TraH family lipoprotein -
CES89_RS29065 (CES89_29065) 43051..43830 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
CES89_RS29070 (CES89_29070) 43841..45004 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
CES89_RS29075 (CES89_29075) 44994..45254 + 261 WP_004187310 IcmT/TraK family protein traK
CES89_RS30290 45279..47378 + 2100 WP_227522597 DUF5710 domain-containing protein -
CES89_RS30415 47375..47455 + 81 Protein_67 hypothetical protein -
CES89_RS30300 47524..48222 + 699 WP_227522610 hypothetical protein -
CES89_RS30305 48162..48593 + 432 WP_227522598 hypothetical protein -
CES89_RS29090 (CES89_29090) 49483..49788 - 306 WP_227522599 hypothetical protein -
CES89_RS30315 49869..50156 + 288 WP_227522611 hypothetical protein traM
CES89_RS29095 (CES89_29095) 50128..50583 + 456 WP_264755453 DotI/IcmL family type IV secretion protein traM
CES89_RS30320 (CES89_29100) 50586..50864 - 279 WP_227522601 hypothetical protein -
CES89_RS30420 (CES89_29110) 51117..51749 + 633 Protein_74 DotH/IcmK family type IV secretion protein -
CES89_RS30335 51761..52642 + 882 WP_227522602 conjugal transfer protein TraO traO
CES89_RS30340 52728..53135 + 408 WP_227522603 hypothetical protein traO
CES89_RS30425 53122..53250 + 129 WP_264755454 hypothetical protein -
CES89_RS29120 (CES89_29120) 53297..53827 + 531 WP_264755456 conjugal transfer protein TraP traP
CES89_RS29125 (CES89_29125) 53851..54381 + 531 WP_004187478 conjugal transfer protein TraQ traQ
CES89_RS29130 (CES89_29130) 54398..54787 + 390 WP_004187479 DUF6750 family protein traR
CES89_RS29135 (CES89_29135) 54832..55326 + 495 WP_004187480 hypothetical protein -
CES89_RS30345 55323..56027 + 705 WP_227522604 hypothetical protein traU
CES89_RS29140 (CES89_29140) 55979..58372 + 2394 WP_227522605 conjugal transfer protein traU
CES89_RS30430 58492..58668 + 177 Protein_84 hypothetical protein -
CES89_RS29145 (CES89_29145) 58698..59576 + 879 WP_264755455 conjugal transfer protein TraW traW
CES89_RS29155 (CES89_29155) 59573..62356 + 2784 WP_227522606 DotA/TraY family protein traY
CES89_RS29160 (CES89_29160) 62358..63011 + 654 WP_015060005 hypothetical protein -
CES89_RS29165 (CES89_29165) 63080..63322 + 243 WP_023893611 IncL/M type plasmid replication protein RepC -


Host bacterium


ID   1439 GenBank   NZ_CP022147
Plasmid name   p704SK6_4 Incompatibility group   IncL/M
Plasmid size   63605 bp Coordinate of oriT [Strand]   40150..40255 [+]
Host baterium   Klebsiella pneumoniae isolate 704SK6

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA8