Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100977
Name   oriT_unitig_1_pilon in_silico
Organism   Klebsiella pneumoniae strain AR_0107
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP021956 (3005..3555 [+], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_unitig_1_pilon
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1047 GenBank   WP_001337757
Name   TraI_unitig_1_pilon insolico UniProt ID   _
Length   992 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 992 a.a.        Molecular weight: 109581.85 Da        Isoelectric Point: 4.8956

>WP_001337757.1 MULTISPECIES: MobH family relaxase [Gammaproteobacteria]
MLKALNKLFGGRSGVIETAPSARVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEADDGDDQEEGEAALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGPTESSK
PDAGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPF
DAFNASAETTSTDATNSEIPDVAMPGKQEEQPKQDFVPQEQNSLQGDDFPMFGGSDEPPSWAIEPLPMLT
DAPEQPTHTPEMPHTDNVNQHEKDAKTLLVEMLSGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVI
LYPDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQ
DAFELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKASPEQKAKGKDSQPQPKEKKVDVTSPVEEQQ
RKPVQEKQNVARLPKREAQPVAPEPKVEREKELGHVEVREREDPEVREFEPPKAKTNPKDINAEDFLPSG
VTPQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKK
RQGKLYLEVNET

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(51-357)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1139..27582

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM486_RS27680 (AM486_27625) 1139..3004 + 1866 WP_000178856 conjugative transfer system coupling protein TraD virb4
AM486_RS27685 (AM486_27630) 3054..3599 + 546 WP_000228720 hypothetical protein -
AM486_RS27690 (AM486_27635) 3556..4185 + 630 WP_000743450 DUF4400 domain-containing protein tfc7
AM486_RS27695 (AM486_27640) 4195..4641 + 447 WP_000122506 hypothetical protein -
AM486_RS27700 (AM486_27645) 4651..5028 + 378 WP_000869261 hypothetical protein -
AM486_RS27705 (AM486_27650) 5028..5690 + 663 WP_001231463 hypothetical protein -
AM486_RS29860 5871..6014 + 144 WP_001275801 hypothetical protein -
AM486_RS27710 (AM486_27655) 6026..6391 + 366 WP_001052531 hypothetical protein -
AM486_RS27715 (AM486_27660) 6536..6817 + 282 WP_000805625 type IV conjugative transfer system protein TraL traL
AM486_RS27720 (AM486_27665) 6814..7440 + 627 WP_001049716 TraE/TraK family type IV conjugative transfer system protein traE
AM486_RS27725 (AM486_27670) 7424..8341 + 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
AM486_RS27730 (AM486_27675) 8341..9654 + 1314 WP_024131605 TraB/VirB10 family protein traB
AM486_RS27735 (AM486_27680) 9651..10229 + 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
AM486_RS27740 (AM486_27685) 10233..10625 + 393 WP_000479535 TraA family conjugative transfer protein -
AM486_RS27745 (AM486_27690) 10826..16357 + 5532 WP_088296439 Ig-like domain-containing protein -
AM486_RS27750 (AM486_27695) 16506..17213 + 708 WP_001259347 DsbC family protein -
AM486_RS27755 (AM486_27700) 17210..19657 + 2448 WP_088296440 type IV secretion system protein TraC virb4
AM486_RS27760 (AM486_27705) 19672..19989 + 318 WP_000351984 hypothetical protein -
AM486_RS27765 (AM486_27710) 19986..20516 + 531 WP_001010738 S26 family signal peptidase -
AM486_RS27770 (AM486_27715) 20479..21744 + 1266 WP_000621288 TrbC family F-type conjugative pilus assembly protein traW
AM486_RS27775 (AM486_27720) 21741..21983 + 243 Protein_21 EAL domain-containing protein -
AM486_RS27780 (AM486_27725) 22057..23225 + 1169 WP_085929673 IS3-like element ISEc52 family transposase -
AM486_RS27785 (AM486_27730) 23155..23664 + 510 WP_319823304 EAL domain-containing protein -
AM486_RS27790 (AM486_27735) 23664..24668 + 1005 WP_043940352 TraU family protein traU
AM486_RS27795 (AM486_27740) 24784..27582 + 2799 WP_001256487 conjugal transfer mating pair stabilization protein TraN traN
AM486_RS27800 (AM486_27745) 27621..28481 - 861 WP_000709517 hypothetical protein -
AM486_RS27805 (AM486_27750) 28604..29245 - 642 WP_000796664 hypothetical protein -
AM486_RS27810 (AM486_27755) 29539..29859 + 321 WP_000547566 hypothetical protein -
AM486_RS27815 (AM486_27760) 30163..30348 + 186 WP_001186917 hypothetical protein -
AM486_RS27820 (AM486_27765) 30568..31536 + 969 WP_000085162 AAA family ATPase -
AM486_RS27825 (AM486_27770) 31547..32455 + 909 WP_000739139 hypothetical protein -

Host bacterium

ID   1435 GenBank   NZ_CP021956
Plasmid name   unitig_1_pilon Incompatibility group   IncA/C2
Plasmid size   153527 bp Coordinate of oriT [Strand]   3005..3555 [+]
Host baterium   Klebsiella pneumoniae strain AR_0107

Cargo genes

Drug resistance gene   aac(6')-Ib, ant(3'')-Ia, blaOXA-9, blaTEM-1A, ARR-3, cmlA1, blaOXA-10, qacE, sul1, blaCTX-M-2, rmtG, sul2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -