Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100973
Name   oriT_tig00001069_pilon in_silico
Organism   Escherichia coli strain AR_0137
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP021880 (55570..55859 [-], 290 nt)
oriT length   290 nt
IRs (inverted repeats)      225..232, 235..242 n  (GCAAAAAC..GTTTTTGC)
Location of nic site      251..252
Conserved sequence flanking the
  nic site  
 
 GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 290 nt

>oriT_tig00001069_pilon
CGCACCGCTAGCAGCGCCCCTAGCGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGTTGTAGCCGCGCCGACACCGCTTTTTTAAATATCATAAAGAGAGTAAGAGAAACTAATTTTTCATAACTCTCTATTTATAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1043 GenBank   WP_013362805
Name   TraI_tig00001069_pilon insolico UniProt ID   _
Length   1706 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1706 a.a.        Molecular weight: 186742.95 Da        Isoelectric Point: 5.9554

>WP_013362805.1 MULTISPECIES: conjugative transfer relaxase/helicase TraI [Enterobacteriaceae]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIRETVGEDASLKSRDVAALDTRKSKQHVDPEIKMTEWMQT
LKETGFDIRAYRDAAEQRAYTRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
AGVIERARAGIDEAISREQLIPLDREKGMFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELAMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKYAGVNTYRW
QGGEQRPATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISLQKTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVEKALSGLESVKPSQVPRLEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGRSAG
IWLNPLTTDDGNGLRGFSGEGRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRE
TERRADEIVRKMAENKPDLPDGKTELAVRDIAGQERDRTATSERETALPESVLRESQREREAVREVAREN
LLQRLLQQMERDMVRDLQKEKTLGGD

  Protein domains


Predicted by InterproScan.

(10-283)

(968-1156)

(633-712)

(575-626)

(1434-1557)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 55008..81394

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM384_RS26905 50692..50880 - 189 WP_001299721 hypothetical protein -
AM384_RS24695 (AM384_24595) 50937..52306 + 1370 WP_085947770 IS3-like element IS150 family transposase -
AM384_RS27525 52348..52497 + 150 Protein_62 plasmid maintenance protein Mok -
AM384_RS24700 (AM384_24600) 52439..52564 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
AM384_RS27530 (AM384_24605) 52784..53014 + 231 WP_071886920 hypothetical protein -
AM384_RS27535 53012..53184 - 173 Protein_65 hypothetical protein -
AM384_RS27540 (AM384_24615) 53254..53460 + 207 WP_000547968 hypothetical protein -
AM384_RS24710 (AM384_24620) 53485..53772 + 288 WP_000107535 hypothetical protein -
AM384_RS24715 (AM384_24625) 53890..54711 + 822 WP_001234426 DUF932 domain-containing protein -
AM384_RS24720 (AM384_24630) 55008..55610 - 603 WP_013362798 transglycosylase SLT domain-containing protein virB1
AM384_RS24725 (AM384_24635) 55931..56314 + 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
AM384_RS24730 (AM384_24640) 56501..57190 + 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
AM384_RS24735 (AM384_24645) 57289..57684 + 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
AM384_RS24740 (AM384_24650) 57717..58082 + 366 WP_000994779 type IV conjugative transfer system pilin TraA -
AM384_RS24745 (AM384_24655) 58097..58408 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
AM384_RS24750 (AM384_24660) 58430..58996 + 567 WP_021514868 type IV conjugative transfer system protein TraE traE
AM384_RS24755 (AM384_24665) 58983..59711 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
AM384_RS24760 (AM384_24670) 59711..61138 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
AM384_RS24765 (AM384_24675) 61128..61718 + 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
AM384_RS24770 (AM384_24680) 61705..61902 + 198 WP_001324648 conjugal transfer protein TrbD -
AM384_RS24775 (AM384_24685) 61914..62165 + 252 WP_001038342 conjugal transfer protein TrbG -
AM384_RS24780 (AM384_24690) 62162..62677 + 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
AM384_RS24785 (AM384_24695) 62812..63033 + 222 WP_001278689 conjugal transfer protein TraR -
AM384_RS24790 (AM384_24700) 63193..65820 + 2628 WP_001064245 type IV secretion system protein TraC virb4
AM384_RS24795 (AM384_24705) 65817..66203 + 387 WP_000099686 type-F conjugative transfer system protein TrbI -
AM384_RS24800 (AM384_24710) 66200..66832 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
AM384_RS24805 (AM384_24715) 66829..67821 + 993 WP_088263319 conjugal transfer pilus assembly protein TraU traU
AM384_RS24810 (AM384_24720) 67830..68468 + 639 WP_021518374 type-F conjugative transfer system pilin assembly protein TrbC trbC
AM384_RS24815 (AM384_24725) 68465..70273 + 1809 WP_000821840 type-F conjugative transfer system mating-pair stabilization protein TraN traN
AM384_RS24820 (AM384_24730) 70300..70557 + 258 WP_000864312 conjugal transfer protein TrbE -
AM384_RS24825 (AM384_24735) 70550..71293 + 744 WP_001030378 type-F conjugative transfer system pilin assembly protein TraF traF
AM384_RS24830 (AM384_24740) 71307..71648 + 342 WP_000556794 conjugal transfer protein TrbA -
AM384_RS24835 (AM384_24745) 71629..71964 - 336 WP_000415571 hypothetical protein -
AM384_RS24840 (AM384_24750) 72045..72329 + 285 WP_000624105 type-F conjugative transfer system pilin chaperone TraQ -
AM384_RS24845 (AM384_24755) 72316..72870 + 555 WP_001553830 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
AM384_RS24850 (AM384_24760) 72860..73174 + 315 WP_023149603 P-type conjugative transfer protein TrbJ -
AM384_RS24855 (AM384_24765) 73128..73520 + 393 WP_000164675 F-type conjugal transfer protein TrbF -
AM384_RS24860 (AM384_24770) 73507..74880 + 1374 WP_021518370 conjugal transfer pilus assembly protein TraH traH
AM384_RS24865 (AM384_24775) 74877..77702 + 2826 WP_001553826 conjugal transfer mating-pair stabilization protein TraG traG
AM384_RS24870 (AM384_24780) 77699..78208 + 510 WP_000628100 conjugal transfer entry exclusion protein TraS -
AM384_RS24875 (AM384_24785) 78222..78953 + 732 WP_000850424 conjugal transfer complement resistance protein TraT -
AM384_RS24880 (AM384_24790) 79205..81394 + 2190 WP_040110343 type IV conjugative transfer system coupling protein TraD virb4


Host bacterium


ID   1431 GenBank   NZ_CP021880
Plasmid name   tig00001069_pilon Incompatibility group   IncFIB
Plasmid size   169449 bp Coordinate of oriT [Strand]   55570..55859 [-]
Host baterium   Escherichia coli strain AR_0137

Cargo genes


Drug resistance gene   sitABCD, aac(6')-Ib-cr, blaOXA-1, aac(3)-IIa, blaCTX-M-15, aadA5, qacE, sul1, mph(A), tet(B)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -