Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100972
Name   oriT_pEC1515-1 in_silico
Organism   Escherichia coli strain EC1515
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP021845 (44719..44828 [+], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GTAATTGTAATAGCGTC..GACGGTATTACAATTAC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pEC1515-1
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGTAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTACACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1042 GenBank   WP_011264053
Name   NikB_pEC1515-1 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103882.34 Da        Isoelectric Point: 7.4198

>WP_011264053.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELNLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIAQQAHYAKDNTDPVFHYILSWQAHESPRPEQIYDSVR
HTLKSLGLGEHQYVSAVHTDTDNLHVHVAVNRVHPVTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1862..36818

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CDH89_RS26065 (CDH89_26045) 557..1711 + 1155 WP_001139955 site-specific integrase -
CDH89_RS26070 (CDH89_26050) 1862..2686 + 825 WP_023518851 conjugal transfer protein TraE traE
CDH89_RS26075 (CDH89_26055) 2772..3974 + 1203 WP_000976351 conjugal transfer protein TraF -
CDH89_RS26080 (CDH89_26060) 4034..4618 + 585 WP_000977522 histidine phosphatase family protein -
CDH89_RS26085 (CDH89_26065) 5013..5471 + 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
CDH89_RS26090 (CDH89_26070) 5468..6286 + 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
CDH89_RS26095 (CDH89_26075) 6283..7431 + 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
CDH89_RS26100 (CDH89_26080) 7428..7718 + 291 WP_001299214 hypothetical protein traK
CDH89_RS26105 (CDH89_26085) 7733..8284 + 552 WP_000014584 phospholipase D family protein -
CDH89_RS26110 (CDH89_26090) 8374..12141 + 3768 WP_023518849 LPD7 domain-containing protein -
CDH89_RS26115 (CDH89_26095) 12159..12506 + 348 WP_001055900 conjugal transfer protein traL
CDH89_RS26120 (CDH89_26100) 12503..13195 + 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
CDH89_RS26125 (CDH89_26105) 13206..14189 + 984 WP_001191880 IncI1-type conjugal transfer protein TraN traN
CDH89_RS26130 (CDH89_26110) 14192..15481 + 1290 WP_011264042 conjugal transfer protein TraO traO
CDH89_RS26135 (CDH89_26115) 15481..16185 + 705 WP_001493811 IncI1-type conjugal transfer protein TraP traP
CDH89_RS26140 (CDH89_26120) 16185..16712 + 528 WP_001055569 conjugal transfer protein TraQ traQ
CDH89_RS26145 (CDH89_26125) 16763..17167 + 405 WP_000086965 IncI1-type conjugal transfer protein TraR traR
CDH89_RS26150 (CDH89_26130) 17231..17419 + 189 WP_001277255 putative conjugal transfer protein TraS -
CDH89_RS26155 (CDH89_26135) 17403..18203 + 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
CDH89_RS26160 (CDH89_26140) 18293..21337 + 3045 WP_023518848 IncI1-type conjugal transfer protein TraU traU
CDH89_RS26165 (CDH89_26145) 21337..21951 + 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
CDH89_RS26170 (CDH89_26150) 21918..23120 + 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
CDH89_RS26175 (CDH89_26155) 23149..23733 + 585 WP_001746157 IncI1-type conjugal transfer protein TraX -
CDH89_RS26180 (CDH89_26160) 23830..25998 + 2169 WP_023518847 DotA/TraY family protein traY
CDH89_RS26185 (CDH89_26165) 26069..26731 + 663 WP_000644796 plasmid IncI1-type surface exclusion protein ExcA -
CDH89_RS26190 (CDH89_26170) 26803..27012 - 210 WP_000062603 HEAT repeat domain-containing protein -
CDH89_RS28600 27404..27580 + 177 WP_001054897 hypothetical protein -
CDH89_RS29160 27645..27740 - 96 WP_000609148 DinQ-like type I toxin DqlB -
CDH89_RS26200 (CDH89_26180) 28241..28492 + 252 WP_001291964 hypothetical protein -
CDH89_RS26205 (CDH89_26185) 28564..28716 - 153 WP_001387489 Hok/Gef family protein -
CDH89_RS28385 29037..29411 + 375 WP_249537783 hypothetical protein -
CDH89_RS26215 (CDH89_26195) 29564..30826 + 1263 WP_000608644 IS1380-like element ISEcp1 family transposase -
CDH89_RS26220 (CDH89_26200) 31150..32295 + 1146 WP_015056382 class C beta-lactamase CMY-4 -
CDH89_RS26225 (CDH89_26205) 32389..32922 + 534 WP_001221666 lipocalin family protein -
CDH89_RS26230 (CDH89_26210) 32919..33236 - 318 WP_000118520 quaternary ammonium compound efflux SMR transporter SugE -
CDH89_RS26235 (CDH89_26215) 33432..34214 + 783 WP_023063753 protein FinQ -
CDH89_RS26240 (CDH89_26220) 34521..35729 + 1209 WP_011264049 IncI1-type conjugal transfer protein TrbA trbA
CDH89_RS26245 (CDH89_26225) 35748..36818 + 1071 WP_011264050 IncI1-type conjugal transfer protein TrbB trbB
CDH89_RS26250 (CDH89_26230) 36811..38817 + 2007 Protein_40 F-type conjugative transfer protein TrbC -
CDH89_RS26255 (CDH89_26235) 38902..39327 + 426 WP_000422741 transposase -
CDH89_RS26260 (CDH89_26240) 39324..39674 + 351 WP_000624722 IS66 family insertion sequence element accessory protein TnpB -
CDH89_RS26265 (CDH89_26245) 39705..41318 + 1614 WP_000080193 IS66-like element ISEc23 family transposase -
CDH89_RS26270 (CDH89_26250) 41349..41642 + 294 Protein_44 conjugal transfer protein TrbC -

Region 2: 98869..123828

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CDH89_RS26710 (CDH89_26690) 93931..94998 + 1068 WP_001360287 type IV pilus biogenesis lipoprotein PilL -
CDH89_RS26715 (CDH89_26695) 94998..95435 + 438 WP_000539806 type IV pilus biogenesis protein PilM -
CDH89_RS26720 (CDH89_26700) 95449..97131 + 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
CDH89_RS26725 (CDH89_26705) 97124..98419 + 1296 WP_023518855 type 4b pilus protein PilO2 -
CDH89_RS26730 (CDH89_26710) 98406..98858 + 453 WP_001247337 type IV pilus biogenesis protein PilP -
CDH89_RS26735 (CDH89_26715) 98869..100422 + 1554 WP_023518854 ATPase, T2SS/T4P/T4SS family virB11
CDH89_RS26740 (CDH89_26720) 100435..101520 + 1086 WP_001208802 type II secretion system F family protein -
CDH89_RS26745 (CDH89_26725) 101537..102151 + 615 WP_000908227 type 4 pilus major pilin -
CDH89_RS26750 (CDH89_26730) 102161..102721 + 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
CDH89_RS26755 (CDH89_26735) 102706..103362 + 657 WP_001401940 A24 family peptidase -
CDH89_RS26760 (CDH89_26740) 103362..104652 + 1291 Protein_123 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
CDH89_RS29235 105272..105532 - 261 Protein_124 Shufflon protein B -
CDH89_RS29000 (CDH89_26760) 105882..106183 - 302 Protein_125 shufflon protein C -
CDH89_RS26785 (CDH89_26765) 106182..107336 + 1155 WP_001139955 site-specific integrase -
CDH89_RS26790 (CDH89_26770) 107487..108311 + 825 WP_023518851 conjugal transfer protein TraE traE
CDH89_RS26795 (CDH89_26775) 108397..109599 + 1203 WP_000976351 conjugal transfer protein TraF -
CDH89_RS26800 (CDH89_26780) 109659..110243 + 585 WP_000977522 histidine phosphatase family protein -
CDH89_RS26805 (CDH89_26785) 110638..111096 + 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
CDH89_RS26810 (CDH89_26790) 111093..111911 + 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
CDH89_RS26815 (CDH89_26795) 111908..113056 + 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
CDH89_RS26820 (CDH89_26800) 113053..113343 + 291 WP_001299214 hypothetical protein traK
CDH89_RS26825 (CDH89_26805) 113358..113909 + 552 WP_000014584 phospholipase D family protein -
CDH89_RS26830 (CDH89_26810) 113999..117766 + 3768 WP_023518849 LPD7 domain-containing protein -
CDH89_RS26835 (CDH89_26815) 117784..118131 + 348 WP_001055900 conjugal transfer protein traL
CDH89_RS26840 (CDH89_26820) 118128..118820 + 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
CDH89_RS26845 (CDH89_26825) 118831..119814 + 984 WP_001191880 IncI1-type conjugal transfer protein TraN traN
CDH89_RS26850 (CDH89_26830) 119817..121106 + 1290 WP_011264042 conjugal transfer protein TraO traO
CDH89_RS26855 (CDH89_26835) 121106..121810 + 705 WP_001493811 IncI1-type conjugal transfer protein TraP traP
CDH89_RS26860 (CDH89_26840) 121810..122337 + 528 WP_001055569 conjugal transfer protein TraQ traQ
CDH89_RS26865 (CDH89_26845) 122388..122792 + 405 WP_000086965 IncI1-type conjugal transfer protein TraR traR
CDH89_RS26870 (CDH89_26850) 122856..123044 + 189 WP_001277255 putative conjugal transfer protein TraS -
CDH89_RS26875 (CDH89_26855) 123028..123828 + 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT


Host bacterium


ID   1430 GenBank   NZ_CP021845
Plasmid name   pEC1515-1 Incompatibility group   IncI1
Plasmid size   125099 bp Coordinate of oriT [Strand]   44719..44828 [+]
Host baterium   Escherichia coli strain EC1515

Cargo genes


Drug resistance gene   blaCMY-4, aac(3)-IId, ant(3'')-Ia
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2