Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100971
Name   oriT_tig00000516_pilon in_silico
Organism   Klebsiella pneumoniae strain AR_0120
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP021835 (32151..32701 [-], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_tig00000516_pilon
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1041 GenBank   WP_001337757
Name   TraI_tig00000516_pilon insolico UniProt ID   _
Length   992 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 992 a.a.        Molecular weight: 109581.85 Da        Isoelectric Point: 4.8956

>WP_001337757.1 MULTISPECIES: MobH family relaxase [Gammaproteobacteria]
MLKALNKLFGGRSGVIETAPSARVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEADDGDDQEEGEAALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGPTESSK
PDAGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPF
DAFNASAETTSTDATNSEIPDVAMPGKQEEQPKQDFVPQEQNSLQGDDFPMFGGSDEPPSWAIEPLPMLT
DAPEQPTHTPEMPHTDNVNQHEKDAKTLLVEMLSGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVI
LYPDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQ
DAFELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKASPEQKAKGKDSQPQPKEKKVDVTSPVEEQQ
RKPVQEKQNVARLPKREAQPVAPEPKVEREKELGHVEVREREDPEVREFEPPKAKTNPKDINAEDFLPSG
VTPQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKK
RQGKLYLEVNET

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(51-357)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 9376..34567

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM367_RS28995 (AM367_28950) 4503..5411 - 909 WP_000739139 hypothetical protein -
AM367_RS29000 (AM367_28955) 5422..6390 - 969 WP_000085162 AAA family ATPase -
AM367_RS29005 (AM367_28960) 6610..6795 - 186 WP_001186917 hypothetical protein -
AM367_RS29010 (AM367_28965) 7099..7419 - 321 WP_000547566 hypothetical protein -
AM367_RS29015 (AM367_28970) 7713..8354 + 642 WP_000796664 hypothetical protein -
AM367_RS29020 (AM367_28975) 8477..9337 + 861 WP_000709517 hypothetical protein -
AM367_RS29025 (AM367_28980) 9376..12174 - 2799 WP_001256487 conjugal transfer mating pair stabilization protein TraN traN
AM367_RS29030 (AM367_28985) 12290..13294 - 1005 WP_043940352 TraU family protein traU
AM367_RS29035 (AM367_28990) 13294..13965 - 672 WP_001337754 EAL domain-containing protein -
AM367_RS29040 (AM367_28995) 13962..15227 - 1266 WP_000621288 TrbC family F-type conjugative pilus assembly protein traW
AM367_RS29045 (AM367_29000) 15190..15720 - 531 WP_001010738 S26 family signal peptidase -
AM367_RS29050 (AM367_29005) 15717..16034 - 318 WP_000351984 hypothetical protein -
AM367_RS29055 (AM367_29010) 16049..18496 - 2448 WP_000637386 type IV secretion system protein TraC virb4
AM367_RS29060 (AM367_29015) 18493..19200 - 708 WP_001259347 DsbC family protein -
AM367_RS29065 (AM367_29020) 19349..24880 - 5532 WP_000606833 Ig-like domain-containing protein -
AM367_RS29070 (AM367_29025) 25081..25473 - 393 WP_000479535 TraA family conjugative transfer protein -
AM367_RS29075 (AM367_29030) 25477..26055 - 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
AM367_RS29080 (AM367_29035) 26052..27365 - 1314 WP_024131605 TraB/VirB10 family protein traB
AM367_RS29085 (AM367_29040) 27365..28282 - 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
AM367_RS29090 (AM367_29045) 28266..28892 - 627 WP_001049716 TraE/TraK family type IV conjugative transfer system protein traE
AM367_RS29095 (AM367_29050) 28889..29170 - 282 WP_000805625 type IV conjugative transfer system protein TraL traL
AM367_RS29100 (AM367_29055) 29315..29680 - 366 WP_001052531 hypothetical protein -
AM367_RS31615 29692..29835 - 144 WP_001275801 hypothetical protein -
AM367_RS29105 (AM367_29060) 30016..30678 - 663 WP_001231463 hypothetical protein -
AM367_RS29110 (AM367_29065) 30678..31055 - 378 WP_000869261 hypothetical protein -
AM367_RS29115 (AM367_29070) 31065..31511 - 447 WP_000122506 hypothetical protein -
AM367_RS29120 (AM367_29075) 31521..32150 - 630 WP_000743450 DUF4400 domain-containing protein tfc7
AM367_RS29125 (AM367_29080) 32107..32652 - 546 WP_000228720 hypothetical protein -
AM367_RS29130 (AM367_29085) 32702..34567 - 1866 WP_000178856 conjugative transfer system coupling protein TraD virb4
AM367_RS29135 (AM367_29090) 34564..37542 - 2979 WP_001337757 MobH family relaxase -
AM367_RS29140 (AM367_29095) 37710..38327 + 618 WP_001249396 hypothetical protein -
AM367_RS29145 (AM367_29100) 38309..38542 + 234 WP_001191892 hypothetical protein -

Host bacterium

ID   1429 GenBank   NZ_CP021835
Plasmid name   tig00000516_pilon Incompatibility group   IncA/C2
Plasmid size   210045 bp Coordinate of oriT [Strand]   32151..32701 [-]
Host baterium   Klebsiella pneumoniae strain AR_0120

Cargo genes

Drug resistance gene   floR, sul2, blaKPC-2, sul1, qacE, aac(6')-33, ant(2'')-Ia, blaTEM-1D
Virulence gene   -
Metal resistance gene   merR, merT, merP, merA, merD, merE, merC
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -