Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100969
Name   oriT_tig00000002jNODE_23 in_silico
Organism   Klebsiella pneumoniae strain AR_0126
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP021742 (42732..42836 [-], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      18..35, 42..59  (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 105 nt

>oriT_tig00000002jNODE_23
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1039 GenBank   WP_004206924
Name   Putativerelaxaseoftig00000002jNODE_23 insolico UniProt ID   A0A0U3I0I2
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A0U3I0I2


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 20738..39934

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM373_RS27745 (AM373_27600) 16721..17254 + 534 Protein_21 IS110-like element IS4321 family transposase -
AM373_RS27750 (AM373_27605) 18426..19493 - 1068 WP_020316718 plasmid replication initiator RepA -
AM373_RS27755 (AM373_27610) 19778..20008 - 231 WP_004187496 IncL/M type plasmid replication protein RepC -
AM373_RS27760 (AM373_27615) 20082..20735 - 654 WP_004206935 hypothetical protein -
AM373_RS27765 (AM373_27620) 20738..22918 - 2181 WP_004187492 DotA/TraY family protein traY
AM373_RS27770 (AM373_27625) 22911..23561 - 651 WP_004187488 hypothetical protein -
AM373_RS27775 (AM373_27630) 23558..24766 - 1209 WP_004187486 conjugal transfer protein TraW traW
AM373_RS27780 (AM373_27635) 24763..27813 - 3051 WP_011154474 conjugative transfer protein traU
AM373_RS27785 (AM373_27640) 27810..28304 - 495 WP_004187480 hypothetical protein -
AM373_RS27790 (AM373_27645) 28350..28739 - 390 WP_011154472 DUF6750 family protein traR
AM373_RS27795 (AM373_27650) 28756..29286 - 531 WP_004187478 conjugal transfer protein TraQ traQ
AM373_RS27800 (AM373_27655) 29310..30014 - 705 WP_004206933 conjugal transfer protein TraP traP
AM373_RS27805 (AM373_27660) 30026..31375 - 1350 WP_004206932 conjugal transfer protein TraO traO
AM373_RS27810 (AM373_27665) 31387..32538 - 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
AM373_RS27815 (AM373_27670) 32547..33260 - 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
AM373_RS27820 (AM373_27675) 33328..33738 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
AM373_RS27825 (AM373_27680) 33767..33922 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
AM373_RS27830 (AM373_27685) 33923..34435 - 513 WP_011091071 hypothetical protein traL
AM373_RS29375 34401..37706 - 3306 WP_227516140 LPD7 domain-containing protein -
AM373_RS27840 (AM373_27695) 37731..37991 - 261 WP_004187310 IcmT/TraK family protein traK
AM373_RS27845 (AM373_27700) 37981..39144 - 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
AM373_RS27850 (AM373_27705) 39155..39934 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
AM373_RS27855 (AM373_27710) 39931..40431 - 501 WP_004206925 DotD/TraH family lipoprotein -
AM373_RS27860 (AM373_27715) 40445..42424 - 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
AM373_RS27865 (AM373_27720) 42411..42728 - 318 WP_004206923 plasmid mobilization protein MobA -
AM373_RS27870 (AM373_27725) 43004..43300 + 297 WP_227520851 MobC -
AM373_RS29380 43867..44022 - 156 WP_227520852 hypothetical protein -

Host bacterium

ID   1427 GenBank   NZ_CP021742
Plasmid name   tig00000002jNODE_23 Incompatibility group   IncL/M
Plasmid size   76179 bp Coordinate of oriT [Strand]   42732..42836 [-]
Host baterium   Klebsiella pneumoniae strain AR_0126

Cargo genes

Drug resistance gene   blaSHV-30, sul1, qacE, ARR-3, catB3, blaOXA-1, aac(6')-Ib-cr
Virulence gene   -
Metal resistance gene   merR, merT, merP, merC
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -