Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100967 |
| Name | oriT_unitig_1-pAR_0114  |
| Organism | Escherichia coli strain AR_0114 |
| Sequence Completeness | intact |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP021733 (12258..12547 [+], 290 nt) |
| oriT length | 290 nt |
| IRs (inverted repeats) | 225..232, 235..242 n (GCAAAAAC..GTTTTTGC) |
| Location of nic site | 251..252 |
| Conserved sequence flanking the nic site |
GTGGGGTGT|GG |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 290 nt
>oriT_unitig_1-pAR_0114
CGCACCGCTAGCAGCGCCCCTAGCGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGTTGTAGCCGCGCCGACACCGCTTTTTTAAATATCATAAAGAGAGTAAGAGAAACTAATTTTTCATAACTCTCTATTTATAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCT
CGCACCGCTAGCAGCGCCCCTAGCGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGTTGTAGCCGCGCCGACACCGCTTTTTTAAATATCATAAAGAGAGTAAGAGAAACTAATTTTTCATAACTCTCTATTTATAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 1037 | GenBank | WP_000130000 |
| Name | Relaxaseofunitig_1-pAR_0114 |
UniProt ID | _ |
| Length | 101 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 101 a.a. Molecular weight: 11477.11 Da Isoelectric Point: 7.5204
>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 296..13109
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM361_RS24515 (AM361_24430) | 296..1288 | - | 993 | WP_000830180 | conjugal transfer pilus assembly protein TraU | traU |
| AM361_RS24520 (AM361_24435) | 1285..1917 | - | 633 | WP_001203726 | type-F conjugative transfer system protein TraW | traW |
| AM361_RS24525 (AM361_24440) | 1914..2300 | - | 387 | WP_000099686 | type-F conjugative transfer system protein TrbI | - |
| AM361_RS24530 (AM361_24445) | 2297..4924 | - | 2628 | WP_001064245 | type IV secretion system protein TraC | virb4 |
| AM361_RS24535 (AM361_24450) | 5084..5305 | - | 222 | WP_001278689 | conjugal transfer protein TraR | - |
| AM361_RS24540 (AM361_24455) | 5440..5955 | - | 516 | WP_000809838 | type IV conjugative transfer system lipoprotein TraV | traV |
| AM361_RS24545 (AM361_24460) | 5952..6203 | - | 252 | WP_001038342 | conjugal transfer protein TrbG | - |
| AM361_RS24550 (AM361_24465) | 6215..6412 | - | 198 | WP_001324648 | conjugal transfer protein TrbD | - |
| AM361_RS24555 (AM361_24470) | 6399..6989 | - | 591 | WP_000002787 | conjugal transfer pilus-stabilizing protein TraP | - |
| AM361_RS24560 (AM361_24475) | 6979..8406 | - | 1428 | WP_000146685 | F-type conjugal transfer pilus assembly protein TraB | traB |
| AM361_RS24565 (AM361_24480) | 8406..9134 | - | 729 | WP_001230787 | type-F conjugative transfer system secretin TraK | traK |
| AM361_RS24570 (AM361_24485) | 9121..9687 | - | 567 | WP_000399792 | type IV conjugative transfer system protein TraE | traE |
| AM361_RS24575 (AM361_24490) | 9709..10020 | - | 312 | WP_000012106 | type IV conjugative transfer system protein TraL | traL |
| AM361_RS24580 (AM361_24495) | 10035..10400 | - | 366 | WP_000994779 | type IV conjugative transfer system pilin TraA | - |
| AM361_RS24585 (AM361_24500) | 10433..10828 | - | 396 | WP_001309237 | conjugal transfer relaxosome DNA-bindin protein TraY | - |
| AM361_RS24590 (AM361_24505) | 10927..11616 | - | 690 | WP_000283385 | conjugal transfer transcriptional regulator TraJ | - |
| AM361_RS24595 (AM361_24510) | 11803..12186 | - | 384 | WP_001151524 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| AM361_RS24600 (AM361_24515) | 12519..13109 | + | 591 | WP_192849409 | transglycosylase SLT domain-containing protein | virB1 |
| AM361_RS24605 (AM361_24520) | 13406..14227 | - | 822 | WP_001234426 | DUF932 domain-containing protein | - |
| AM361_RS24610 (AM361_24525) | 14345..14632 | - | 288 | WP_000107535 | hypothetical protein | - |
| AM361_RS27010 (AM361_24530) | 14657..14863 | - | 207 | WP_000547968 | hypothetical protein | - |
| AM361_RS27015 | 14933..15105 | + | 173 | Protein_22 | hypothetical protein | - |
| AM361_RS27020 (AM361_24540) | 15103..15333 | - | 231 | WP_071886920 | hypothetical protein | - |
| AM361_RS24620 (AM361_24545) | 15553..15678 | - | 126 | WP_001372321 | type I toxin-antitoxin system Hok family toxin | - |
| AM361_RS27025 | 15620..15769 | - | 150 | Protein_25 | plasmid maintenance protein Mok | - |
| AM361_RS26460 | 15791..15979 | + | 189 | WP_001299721 | hypothetical protein | - |
| AM361_RS24625 (AM361_24550) | 15948..16710 | - | 763 | Protein_27 | plasmid SOS inhibition protein A | - |
| AM361_RS24630 (AM361_24555) | 16707..17141 | - | 435 | WP_000845937 | conjugation system SOS inhibitor PsiB | - |
| AM361_RS24635 (AM361_24560) | 17196..17393 | - | 198 | Protein_29 | hypothetical protein | - |
| AM361_RS24640 (AM361_24565) | 17421..17654 | - | 234 | WP_000005990 | DUF905 family protein | - |
Region 2: 100990..113919
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM361_RS25270 (AM361_25180) | 100990..103179 | - | 2190 | WP_040110343 | type IV conjugative transfer system coupling protein TraD | virb4 |
| AM361_RS25275 (AM361_25185) | 103431..104162 | - | 732 | WP_000850424 | conjugal transfer complement resistance protein TraT | - |
| AM361_RS25280 (AM361_25190) | 104176..104685 | - | 510 | WP_000628100 | conjugal transfer entry exclusion protein TraS | - |
| AM361_RS25285 (AM361_25195) | 104682..107507 | - | 2826 | WP_001553826 | conjugal transfer mating-pair stabilization protein TraG | traG |
| AM361_RS25290 (AM361_25200) | 107504..108877 | - | 1374 | WP_021518370 | conjugal transfer pilus assembly protein TraH | traH |
| AM361_RS25295 (AM361_25205) | 108864..109256 | - | 393 | WP_000164675 | F-type conjugal transfer protein TrbF | - |
| AM361_RS25300 (AM361_25210) | 109210..109524 | - | 315 | WP_023149603 | P-type conjugative transfer protein TrbJ | - |
| AM361_RS25305 (AM361_25215) | 109514..110068 | - | 555 | WP_001553830 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| AM361_RS25310 (AM361_25220) | 110055..110339 | - | 285 | WP_000624105 | type-F conjugative transfer system pilin chaperone TraQ | - |
| AM361_RS25315 (AM361_25225) | 110420..110755 | + | 336 | WP_000415571 | hypothetical protein | - |
| AM361_RS25320 (AM361_25230) | 110736..111077 | - | 342 | WP_000556794 | conjugal transfer protein TrbA | - |
| AM361_RS25325 (AM361_25235) | 111091..111834 | - | 744 | WP_001030378 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| AM361_RS25330 (AM361_25240) | 111827..112084 | - | 258 | WP_000864312 | conjugal transfer protein TrbE | - |
| AM361_RS25335 (AM361_25245) | 112111..113919 | - | 1809 | WP_000821840 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
Host bacterium
| ID | 1425 | GenBank | NZ_CP021733 |
| Plasmid name | unitig_1-pAR_0114 | Incompatibility group | IncFIA |
| Plasmid size | 114267 bp | Coordinate of oriT [Strand] | 12258..12547 [+] |
| Host baterium | Escherichia coli strain AR_0114 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |