Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100964
Name   oriT_tig00000123 in_silico
Organism   Proteus mirabilis strain AR_0155
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP021695 (60377..60927 [-], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_tig00000123
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1034 GenBank   WP_001337757
Name   TraI_tig00000123 insolico UniProt ID   _
Length   992 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 992 a.a.        Molecular weight: 109581.85 Da        Isoelectric Point: 4.8956

>WP_001337757.1 MULTISPECIES: MobH family relaxase [Gammaproteobacteria]
MLKALNKLFGGRSGVIETAPSARVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEADDGDDQEEGEAALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGPTESSK
PDAGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPF
DAFNASAETTSTDATNSEIPDVAMPGKQEEQPKQDFVPQEQNSLQGDDFPMFGGSDEPPSWAIEPLPMLT
DAPEQPTHTPEMPHTDNVNQHEKDAKTLLVEMLSGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVI
LYPDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQ
DAFELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKASPEQKAKGKDSQPQPKEKKVDVTSPVEEQQ
RKPVQEKQNVARLPKREAQPVAPEPKVEREKELGHVEVREREDPEVREFEPPKAKTNPKDINAEDFLPSG
VTPQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKK
RQGKLYLEVNET

  Protein domains


Predicted by InterproScan.

(51-357)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 37602..62793

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM402_RS20830 (AM402_20865) 32729..33637 - 909 WP_000739139 hypothetical protein -
AM402_RS20835 (AM402_20870) 33648..34616 - 969 WP_000085162 AAA family ATPase -
AM402_RS20840 (AM402_20875) 34836..35021 - 186 WP_001186917 hypothetical protein -
AM402_RS20845 (AM402_20880) 35325..35645 - 321 WP_000547566 hypothetical protein -
AM402_RS20850 (AM402_20885) 35939..36580 + 642 WP_000796664 hypothetical protein -
AM402_RS20855 (AM402_20890) 36703..37563 + 861 WP_000709517 hypothetical protein -
AM402_RS20860 (AM402_20895) 37602..40412 - 2811 WP_001909286 conjugal transfer mating pair stabilization protein TraN traN
AM402_RS20865 (AM402_20900) 40516..41520 - 1005 WP_227656952 TraU family protein traU
AM402_RS20870 (AM402_20905) 41520..42191 - 672 WP_001337754 EAL domain-containing protein -
AM402_RS20875 (AM402_20910) 42188..43453 - 1266 WP_000621288 TrbC family F-type conjugative pilus assembly protein traW
AM402_RS20880 (AM402_20915) 43416..43946 - 531 WP_001010738 S26 family signal peptidase -
AM402_RS20885 (AM402_20920) 43943..44260 - 318 WP_000351984 hypothetical protein -
AM402_RS20890 (AM402_20925) 44275..46722 - 2448 WP_000637386 type IV secretion system protein TraC virb4
AM402_RS20895 (AM402_20930) 46719..47426 - 708 WP_001259347 DsbC family protein -
AM402_RS20900 (AM402_20935) 47575..53106 - 5532 WP_000606833 Ig-like domain-containing protein -
AM402_RS20905 (AM402_20940) 53307..53699 - 393 WP_000479535 TraA family conjugative transfer protein -
AM402_RS20910 (AM402_20945) 53703..54281 - 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
AM402_RS20915 (AM402_20950) 54278..55591 - 1314 WP_024131605 TraB/VirB10 family protein traB
AM402_RS20920 (AM402_20955) 55591..56508 - 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
AM402_RS20925 (AM402_20960) 56492..57118 - 627 WP_001049716 TraE/TraK family type IV conjugative transfer system protein traE
AM402_RS20930 (AM402_20965) 57115..57396 - 282 WP_000805625 type IV conjugative transfer system protein TraL traL
AM402_RS20935 (AM402_20970) 57541..57906 - 366 WP_001052531 hypothetical protein -
AM402_RS22400 57918..58061 - 144 WP_001275801 hypothetical protein -
AM402_RS20940 (AM402_20975) 58242..58904 - 663 WP_001231463 hypothetical protein -
AM402_RS20945 (AM402_20980) 58904..59281 - 378 WP_000869261 hypothetical protein -
AM402_RS22405 59523..59699 - 177 WP_169342285 hypothetical protein -
AM402_RS20955 (AM402_20990) 59747..60376 - 630 WP_000743450 DUF4400 domain-containing protein tfc7
AM402_RS20960 (AM402_20995) 60333..60878 - 546 WP_000228720 hypothetical protein -
AM402_RS20965 (AM402_21000) 60928..62793 - 1866 WP_000178856 conjugative transfer system coupling protein TraD virb4
AM402_RS20970 (AM402_21005) 62790..65768 - 2979 WP_001337757 MobH family relaxase -
AM402_RS20975 (AM402_21010) 65936..66553 + 618 WP_001249396 hypothetical protein -
AM402_RS20980 (AM402_21015) 66535..66768 + 234 WP_001191892 hypothetical protein -

Region 2: 98372..108865

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM402_RS21165 (AM402_21200) 93661..94167 + 507 WP_000140066 arsenate reductase ArsC -
AM402_RS21170 (AM402_21205) 94164..95231 + 1068 WP_001272375 ACR3 family arsenite efflux transporter -
AM402_RS21175 (AM402_21210) 95346..95549 + 204 WP_000131871 hypothetical protein -
AM402_RS22180 95586..95651 - 66 Protein_113 type I toxin-antitoxin system ptaRNA1 family toxin -
AM402_RS21185 (AM402_21220) 95737..96762 + 1026 WP_021545039 IS21-like element ISEc57 family transposase -
AM402_RS21190 (AM402_21225) 96841..97931 + 1091 WP_085940413 IS4-like element ISAba1 family transposase -
AM402_RS21195 (AM402_21230) 97984..98349 - 366 Protein_116 single-stranded DNA-binding protein -
AM402_RS21200 (AM402_21235) 98372..99586 - 1215 WP_157673317 TrbI/VirB10 family protein virB10
AM402_RS21205 (AM402_21240) 99579..100025 - 447 WP_087726749 hypothetical protein -
AM402_RS21210 (AM402_21245) 100029..100943 - 915 WP_087726750 P-type conjugative transfer protein TrbG virB9
AM402_RS21215 (AM402_21250) 100955..101599 - 645 WP_071434332 type IV secretion system protein virB8
AM402_RS21220 (AM402_21255) 101596..103203 - 1608 WP_087726751 P-type conjugative transfer protein TrbL virB6
AM402_RS21225 (AM402_21260) 103222..103464 - 243 WP_087726752 hypothetical protein -
AM402_RS21230 (AM402_21265) 103467..104195 - 729 WP_087726753 hypothetical protein -
AM402_RS21235 (AM402_21270) 104192..106627 - 2436 WP_232467378 hypothetical protein virb4
AM402_RS21240 (AM402_21275) 106690..107010 - 321 WP_032300801 conjugal transfer protein TrbD virB3
AM402_RS21245 (AM402_21280) 107016..107375 - 360 WP_087726754 TrbC/VirB2 family protein virB2
AM402_RS21250 (AM402_21285) 107385..108329 - 945 WP_087726755 P-type conjugative transfer ATPase TrbB virB11
AM402_RS21255 (AM402_21290) 108326..108865 - 540 WP_135180852 lytic transglycosylase domain-containing protein virB1
AM402_RS21260 (AM402_21295) 108956..109489 - 534 WP_157673318 S26 family signal peptidase -
AM402_RS21265 (AM402_21300) 109595..109915 + 321 WP_029403601 hypothetical protein -
AM402_RS21270 (AM402_21305) 109972..110217 + 246 WP_029403600 helix-turn-helix transcriptional regulator -
AM402_RS21275 (AM402_21310) 110247..111251 - 1005 WP_082242808 hypothetical protein -
AM402_RS21280 (AM402_21315) 111238..113352 - 2115 WP_087726757 MFS transporter -


Host bacterium


ID   1422 GenBank   NZ_CP021695
Plasmid name   tig00000123 Incompatibility group   IncA/C2
Plasmid size   214441 bp Coordinate of oriT [Strand]   60377..60927 [-]
Host baterium   Proteus mirabilis strain AR_0155

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   mercury resistance
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -