Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100961
Name   oriT_p2-T1 in_silico
Organism   Acidovorax sp. T1
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP021650 (12171..12543 [+], 373 nt)
oriT length   373 nt
IRs (inverted repeats)      IR1: 64..68, 72..76  (GCGCC..GGCGC)
  IR2: 89..107, 110..128  (GTGAAGATAGATAACCGGC..GCCGGTTAGCTAACTTCAC)
Location of nic site      136..137
Conserved sequence flanking the
  nic site    		  CATCCTG|C
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 373 nt

>oriT_p2-T1
GCCTCGCCTCGTCTCTCATGCCGGCGGTAGCCGGCTGCCTCGCAGAGCAGGATGACCCGTTGAGCGCCCCCGGCGCGAATAAGGGACAGTGAAGATAGATAACCGGCTCGCCGGTTAGCTAACTTCACACATCCTGCCCGCCTTACGGCGTTAATAACACCAAGGAAAGTCTACACCAGCCATTACGATTTATCCGCAACTATCGCGCTATCAGGCCGCAAAAGCAGCAACGGATATAGCGAAACCCGCCACAATGGCCCATAATGCCGCTATCGAAGCGTGCCAATGCACGCCGATAGCGGACTTTTTGCGTTTCCGTAGCGCCGCTTAGTAGCGTTACATTTGCGATGAGAGGATTAGATGGACGAACACG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1031 GenBank   WP_011117146
Name   TraI_p2-T1 insolico UniProt ID   Q937B9
Length   746 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 746 a.a.        Molecular weight: 82120.82 Da        Isoelectric Point: 10.8213

>WP_011117146.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Pseudomonadota]
MIAKHVPMRSLGKSDFAGLANYITDAQSKDHRLGHVQATNCEAGSIQDAITEVLATQHTNTRAKGDKTYH
LIVSFRAGEQPSADTLRAIEERICVGLGYGEHQRISAVHNDTDNLHIHIAINKIHPTRHTMHEPYYPHRA
LAELCTALERDYGLERDNHEPRKRGAEGRAADMERHAGVESLVGWVKRECLDEIKGAQSWQELHQVMRDN
GMELRVRANGLVFEAGDGTMVKASTVARDLSKPSLEARLGPFEASPERQAQTTAKRQYRKDPIRLRVNTV
ELYAKYKAEQQNLTTARAQALERARHRKDRLIEAAKRSNRLRRATIKVVGEGRANKKLLYAQASKALRSE
IQAINKQFQQERTALYAEHRRRTWADWLKKEAQHGGADALAALRAREAAQGLKGNTIRGEGQAKPGHAPA
VDNITKKGTIIFRAGMSAVRDDGDRLQVSREATREGLQEALRLAMQRYGNRITVNGTVEFKAQMIRAAVD
SQLPITFTDPALESRRQALLNKENTHERTERPEHRGRTGRGAGGPGQRPAADQHATGAAAVARAGDGRPA
AGRGDRADAGLHAATVHRKPDVGRLGRKPPPQSQHRLRALSELGVVRIAGGSEVLLPRDVPRHVEQQGTQ
PDHALRRGISRPGTGVGQTPPGVAAADKYIAEREAKRLKGFDIPKHSRYTAGDGALTFQGTRTIEGQALA
LLKRGDEVMVMPIDQATARRLTRIAVGDAVSITAKGSIKTSKGRSR

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(12-251)

Large polyvalent protein-associated domain 7 (LPD7)

(422-508)


  Protein structure


Source ID Structure
AlphaFold DB Q937B9


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 27045..37722

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CCX87_RS19945 22151..22579 - 429 WP_001095942 antirestriction protein -
CCX87_RS19950 22748..23017 + 270 WP_001260984 type II toxin-antitoxin system ParD family antitoxin -
CCX87_RS19955 23014..23328 + 315 WP_011117139 type II toxin-antitoxin system RelE/ParE family toxin -
CCX87_RS19970 24651..25871 - 1221 WP_011114072 plasmid replication initiator TrfA -
CCX87_RS19975 25918..26259 - 342 WP_000019167 single-stranded DNA-binding protein -
CCX87_RS19980 26373..26735 + 363 WP_010890126 transcriptional regulator -
CCX87_RS19985 27045..28007 + 963 WP_000132020 P-type conjugative transfer ATPase TrbB virB11
CCX87_RS19990 28024..28488 + 465 WP_011114046 conjugal transfer system pilin TrbC virB2
CCX87_RS19995 28492..28803 + 312 WP_001207961 conjugal transfer protein TrbD virB3
CCX87_RS20000 28800..31358 + 2559 WP_011114047 VirB4 family type IV secretion/conjugal transfer ATPase virb4
CCX87_RS20005 31355..32137 + 783 WP_006122481 conjugal transfer protein TrbF virB8
CCX87_RS20010 32155..33054 + 900 WP_006122480 P-type conjugative transfer protein TrbG virB9
CCX87_RS20015 33057..33545 + 489 WP_006122479 conjugal transfer protein TrbH -
CCX87_RS20020 33550..34971 + 1422 WP_011114050 TrbI/VirB10 family protein virB10
CCX87_RS20025 34992..35756 + 765 WP_010890135 P-type conjugative transfer protein TrbJ virB5
CCX87_RS20030 35766..35993 + 228 WP_000644148 entry exclusion lipoprotein TrbK -
CCX87_RS20035 36004..37722 + 1719 WP_011114051 P-type conjugative transfer protein TrbL virB6
CCX87_RS20040 37740..38327 + 588 WP_010890138 TrbM/KikA/MpfK family conjugal transfer protein -
CCX87_RS20045 38341..38976 + 636 WP_011114052 transglycosylase SLT domain-containing protein -
CCX87_RS20050 39005..39271 + 267 WP_010890140 hypothetical protein -
CCX87_RS20055 39271..39969 + 699 WP_011114053 TraX family protein -
CCX87_RS20060 39985..40416 + 432 WP_001665065 OmpA family protein -
CCX87_RS20065 40571..41245 + 675 WP_011178411 DNA methylase -
CCX87_RS20070 41247..42002 - 756 WP_232476757 recombinase family protein -
CCX87_RS20075 42279..42506 + 228 WP_031943320 antitoxin MazE family protein -

Host bacterium

ID   1419 GenBank   NZ_CP021650
Plasmid name   p2-T1 Incompatibility group   IncP1
Plasmid size   79174 bp Coordinate of oriT [Strand]   12171..12543 [+]
Host baterium   Acidovorax sp. T1

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -