Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100957
Name   oriT_pSmeRU11d in_silico
Organism   Sinorhizobium meliloti RU11/001
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP021216 (45813..45847 [-], 35 nt)
oriT length   35 nt
IRs (inverted repeats)      16..23, 28..35  (TACGTCGC..GCGACGTG)
Location of nic site      7..8
Conserved sequence flanking the
  nic site  
 
 AGGG|CGCA
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 35 nt

>oriT_pSmeRU11d
CCAAGGGCGCAATTATACGTCGCTGGCGCGACGTG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1027 GenBank   WP_017273093
Name   TraA_pSmeRU11d insolico UniProt ID   _
Length   1210 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1210 a.a.        Molecular weight: 134157.79 Da        Isoelectric Point: 7.3633

>WP_017273093.1 Ti-type conjugative transfer relaxase TraA [Sinorhizobium meliloti]
MAVPHFSVSIVARGSGRSAVLSAAYRHCAKMDFEREARTIDYTRKQGLLHEEFVIPEDAPEWLRAMISDR
SVSGASEAFWNSVEAFEKRSDAQLAKDVTIALPIELSAEQNIDLVQDFVARHITAQGMVADWVYHDAPGN
PHIHMMTTLRPLTDDGFGSKKVAVLGPDGRPQRNDAGKIVYELWADGADDFNAFRDGWFACQNRHLALAG
LDIRVDGRSFEKQGIALEPTIHVGVGATAIERKADTAVETASAAAVKLERIELQEERREENARRIQRDPG
LVLDLITREKSVFDERDIARVLHRYIDDPALFQDLMARVLQHPDALRLDSERISFSTGARSPAKYTTYDL
IRIEAEMAQRALWLGRQHSYHVPTRVLGQVFKRHDRLADEQKSAIQHISRDVGIAAVVGRAGAGKTTMMK
AAREAWEAAGYRVVGAALAGKAAEGLEKEAGIASRTLSAWELRWDQDRDDLDDKTVMVLDEAGMVSSRQM
ARFVEAATISGAKLVLVGDPDQLQPIEAGAAFRAISERIGYAGLETIYRQREQWMRDASLDLARGNVSAA
LAAYEQRDMVRTGWTRDDAITTLIADWDRDYDPAKSSLILAHRRRDVRMLNEMARDKLVERGLIEKGHAF
KTEEGSRQFAVGDQIVFLKNEGSIGVKNGMLARVVEAQPGRLVAEIGSGDDCRQVVVEQRFYANVDHGYA
TTVHKSQGATVDRVKVLASSTLDRHLAYVAMTRHREAAELYVGLEEFAQRRGGVLIAHGEAPFEHKPGNR
SSYYVTLGFANGQEHTLWGVDLARAMDVADARIGDRIGIEHAGSERVRLPDGTEANRNSWKVVPVEDLAM
ARMHERLSRDASKETTLDYQNASSYRAALRFADRRGLHLMSVGRTLLRDRLQWTIRQKEKLTDLMSRLAA
VGERLGLRPSVGGERQVRGASEIRNQTNSIIQEDRKPMVAGITTFAKSIEKSVEDKVSADPALKSQWQEV
SARFHLVYADPQAAFNAVNVDAMVGSSETAKATLATISRQPVTFGPLKGKTGLFAGKADSQARETALVNV
PALARDLDEYLQKRAEAERRYEAEERAVRLKVSIDIPALSGAAKQTLERVRDAIDRNDLPSGLEYALADK
MVKAELEGFAKAVSERFGERTFLPLAAKEADGKVFEKLSAGMAPAQKAELHSAWNTMRTVQRLSAHERTA
TALKQAETMRQAKTTGLSLK

  Protein domains


Predicted by InterproScan.

(697-740)

(387-573)

(17-243)

(966-1062)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 25045..48415

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SMRU11_RS01615 (SMRU11_01630) 20995..22239 - 1245 WP_029727888 plasmid replication protein RepC -
SMRU11_RS01620 (SMRU11_01635) 22397..23389 - 993 WP_012477199 plasmid partitioning protein RepB -
SMRU11_RS01625 (SMRU11_01640) 23474..24664 - 1191 WP_012477198 plasmid partitioning protein RepA -
SMRU11_RS01630 (SMRU11_01645) 25045..26010 + 966 WP_012477360 P-type conjugative transfer ATPase TrbB virB11
SMRU11_RS01635 (SMRU11_01650) 26000..26392 + 393 WP_017273081 TrbC/VirB2 family protein virB2
SMRU11_RS01640 (SMRU11_01655) 26385..26684 + 300 WP_012477358 conjugal transfer protein TrbD virB3
SMRU11_RS01645 (SMRU11_01660) 26695..29130 + 2436 WP_017273083 conjugal transfer protein TrbE virb4
SMRU11_RS01650 (SMRU11_01665) 29123..29929 + 807 WP_017273084 P-type conjugative transfer protein TrbJ virB5
SMRU11_RS01655 (SMRU11_01670) 29974..30129 + 156 WP_234705592 entry exclusion protein TrbK -
SMRU11_RS01660 (SMRU11_01675) 30123..31304 + 1182 WP_017273085 P-type conjugative transfer protein TrbL virB6
SMRU11_RS01665 (SMRU11_01680) 31326..31988 + 663 WP_012477352 conjugal transfer protein TrbF virB8
SMRU11_RS01670 (SMRU11_01685) 32040..32834 + 795 WP_017273087 P-type conjugative transfer protein TrbG virB9
SMRU11_RS01675 (SMRU11_01690) 32838..33284 + 447 WP_012477350 conjugal transfer protein TrbH -
SMRU11_RS01680 (SMRU11_01695) 33300..34598 + 1299 WP_012477349 IncP-type conjugal transfer protein TrbI virB10
SMRU11_RS01685 (SMRU11_01700) 34806..35105 + 300 WP_012477348 transcriptional repressor TraM -
SMRU11_RS01690 (SMRU11_01705) 35106..35804 - 699 WP_017273089 autoinducer binding domain-containing protein -
SMRU11_RS01695 (SMRU11_01710) 36124..37734 + 1611 WP_026030850 hypothetical protein -
SMRU11_RS01700 (SMRU11_01715) 37724..38719 + 996 WP_017273092 alpha/beta hydrolase -
SMRU11_RS01705 (SMRU11_01720) 38886..39692 - 807 WP_012477341 DUF3800 domain-containing protein -
SMRU11_RS01710 (SMRU11_01725) 39752..40369 - 618 WP_012477340 TraH family protein virB1
SMRU11_RS01715 (SMRU11_01730) 40384..41550 - 1167 WP_012477339 conjugal transfer protein TraB -
SMRU11_RS01720 (SMRU11_01735) 41540..42106 - 567 WP_080591128 conjugative transfer signal peptidase TraF -
SMRU11_RS01725 (SMRU11_01740) 42103..45735 - 3633 WP_017273093 Ti-type conjugative transfer relaxase TraA -
SMRU11_RS01730 (SMRU11_01745) 45987..46250 + 264 WP_012477336 TraC family protein -
SMRU11_RS01735 (SMRU11_01750) 46255..46470 + 216 WP_017273095 type IV conjugative transfer system coupling protein TraD -
SMRU11_RS01740 (SMRU11_01755) 46457..48415 + 1959 WP_012477334 Ti-type conjugative transfer system protein TraG virb4
SMRU11_RS01745 (SMRU11_01760) 48432..48629 + 198 WP_017273096 hypothetical protein -
SMRU11_RS01750 (SMRU11_01765) 48844..49110 + 267 WP_012477331 WGR domain-containing protein -
SMRU11_RS01755 (SMRU11_01770) 49146..49634 + 489 WP_017273097 thermonuclease family protein -
SMRU11_RS40010 49672..49845 - 174 WP_012477329 hypothetical protein -
SMRU11_RS40015 50108..50278 - 171 WP_017273098 hypothetical protein -
SMRU11_RS01760 (SMRU11_01775) 50599..50907 - 309 WP_012477327 DUF736 domain-containing protein -
SMRU11_RS40020 51365..51538 + 174 WP_017273099 hypothetical protein -
SMRU11_RS01765 (SMRU11_01780) 51542..51754 - 213 Protein_53 zincin-like metallopeptidase domain-containing protein -
SMRU11_RS01770 (SMRU11_01785) 51907..53139 + 1233 WP_017273100 hypothetical protein -


Host bacterium


ID   1415 GenBank   NZ_CP021216
Plasmid name   pSmeRU11d Incompatibility group   _
Plasmid size   166875 bp Coordinate of oriT [Strand]   45813..45847 [-]
Host baterium   Sinorhizobium meliloti RU11/001

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -