Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100956
Name   oriT_p2474-3 in_silico
Organism   Escherichia coli strain strain Z247
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP021208 (58494..58603 [-], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_p2474-3
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1026 GenBank   WP_086353228
Name   Mob_p2474-3 insolico UniProt ID   _
Length   687 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 687 a.a.        Molecular weight: 75762.89 Da        Isoelectric Point: 4.4954

>WP_086353228.1 LPD7 domain-containing protein [Escherichia coli]
MNESAEPSPSPDAVKEEMTVMTEPDDKQSIGISPDTPREEAVNHVTEDIPLQPEPFLPESDGPEEYEDYS
AYQELMNNENPEHLQENSDMPSQPDTGHVQADESELQATTATIEPAVRDEPTPQQPVQSTSPSDNTSSFL
DKARGFFTRKKTDSQAHENSDPTPSAETTTTPPIPDSIVYAPERSDAPISLNMDEILKELDWEKRADRTV
LYKLDGKPAFIDRVNRLEMVNGASNDDRSVLAALAVATKFYGGVIELTGSDAFKQKAMQLIIEHNIDVRM
KLPDQRAELEKLRKEMAVSKDAVVTHQPTPELNRNIPEQPAVPDPVQEKEATQSPASPAAPEASTVSTAP
ASSPAEPGKTADAAPGEEPPGKLRPGESVTAVLHNFGRAEYAPGKGESFFVELKNRSGSKLYWGEQLESL
VKNHQKGDVVTLTLQNREQFILPGEQKARFRNKWSMESVTNGISVSHDNPDKGQRIQAIPVETFMKVAAQ
ISQGWPEEMKALRMPENVGSHLFIGEDRHPVSAPQNANQVTEITSAAPDKLTPVLGSVDKDTRELNLLLV
QSADEHLQGVVRLNGTLYPALATPSADNSQLVINALTDKGLRFAGYGEAVNHDADSTNRPAPELMQFHLK
TREEPLFAAVYTPEKQPDALYRNLGFEQSWQQWSNSQKPEDRQEKTLHQDLSHSPGR

  Protein domains


Predicted by InterproScan.

(207-293)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 63963..84529

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CA270_RS26225 (CA270_26200) 61679..63970 - 2292 WP_012783931 F-type conjugative transfer protein TrbC -
CA270_RS26230 (CA270_26205) 63963..65033 - 1071 WP_012783932 IncI1-type conjugal transfer protein TrbB trbB
CA270_RS26235 (CA270_26210) 65052..66260 - 1209 WP_001703845 IncI1-type conjugal transfer protein TrbA trbA
CA270_RS26240 (CA270_26215) 66567..67346 - 780 WP_275450201 protein FinQ -
CA270_RS26245 (CA270_26220) 67973..68125 + 153 WP_001387489 Hok/Gef family protein -
CA270_RS26250 (CA270_26225) 68197..68448 - 252 WP_001291964 hypothetical protein -
CA270_RS29520 68949..69044 + 96 WP_000609148 DinQ-like type I toxin DqlB -
CA270_RS28820 69109..69285 - 177 WP_001054900 hypothetical protein -
CA270_RS26260 (CA270_26235) 69677..69886 + 210 WP_000062603 HEAT repeat domain-containing protein -
CA270_RS26265 (CA270_26240) 69958..70620 - 663 WP_012783935 plasmid IncI1-type surface exclusion protein ExcA -
CA270_RS26270 (CA270_26245) 70691..72858 - 2168 Protein_85 DotA/TraY family protein -
CA270_RS26275 (CA270_26250) 72955..73539 - 585 WP_012783937 conjugal transfer protein TraX -
CA270_RS26280 (CA270_26255) 73568..74770 - 1203 WP_012783938 IncI1-type conjugal transfer protein TraW traW
CA270_RS26285 (CA270_26260) 74737..75351 - 615 WP_000337394 IncI1-type conjugal transfer protein TraV traV
CA270_RS26290 (CA270_26265) 75351..78395 - 3045 WP_012783939 IncI1-type conjugal transfer protein TraU traU
CA270_RS26295 (CA270_26270) 78485..79285 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
CA270_RS26300 (CA270_26275) 79269..79457 - 189 WP_001277255 putative conjugal transfer protein TraS -
CA270_RS26305 (CA270_26280) 79521..79925 - 405 WP_000086965 IncI1-type conjugal transfer protein TraR traR
CA270_RS26310 (CA270_26285) 79976..80503 - 528 WP_001055569 conjugal transfer protein TraQ traQ
CA270_RS26315 (CA270_26290) 80503..81207 - 705 WP_086353227 IncI1-type conjugal transfer protein TraP traP
CA270_RS26320 (CA270_26295) 81207..82496 - 1290 WP_011264042 conjugal transfer protein TraO traO
CA270_RS26325 (CA270_26300) 82499..83482 - 984 WP_001191880 IncI1-type conjugal transfer protein TraN traN
CA270_RS26330 (CA270_26305) 83493..84185 - 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
CA270_RS26335 (CA270_26310) 84182..84529 - 348 WP_001055900 conjugal transfer protein traL


Host bacterium


ID   1414 GenBank   NZ_CP021208
Plasmid name   p2474-3 Incompatibility group   IncI1
Plasmid size   86725 bp Coordinate of oriT [Strand]   58494..58603 [-]
Host baterium   Escherichia coli strain strain Z247

Cargo genes


Drug resistance gene   blaCTX-M-55
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2