Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100954
Name   oriT_p1002-1 in_silico
Organism   Escherichia coli strain Z1002
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP021203 (137885..138434 [-], 550 nt)
oriT length   550 nt
IRs (inverted repeats)      243..255, 257..269  (TATTTAATAATTC..GAATTATTAAATA)
 311..318, 321..328  (GCAAAAAC..GTTTTTGC)
Location of nic site      337..338
Conserved sequence flanking the
  nic site  
 
 GTAGTGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 550 nt

>oriT_p1002-1
TTACTCTGGCCATAAGATAAAACCTTTCATTATTAAGCAATGAACTTTTCACTATAAATATGCATATAGTGTTTACAAGTAAGAAAGACACTCCTAGCAGCGCCTCTAGGATCATCCTATAAAAAAATGCGATCCGGCGCTAGGGGCGTCCCTAATATATATCAATGTTTTTCATGAAAATTGTCAGTACTGATCCTAATAAGAGTCGCTATAGGGTCGTAACAGGATCGCCAACGACTCTCTATTTAATAATTCAGAATTATTAAATATAAATAGCGTTTGTTAATTACATGATTTAAAACGTAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCTTTTTGTGGAGTGGGTTAAATTATTTACGGATAAAGTCACCAGAGGTGGAAAAATGAAAAAATGGATGTTAGCAATCTGCCTGATGTTTATAAATGGGATCTGCGAAGCCGCCGATTGCTTTGATCTTGCAGGTCGGGATTACAAAATAGACCCGGATTTACTGAGAGCGATATC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1024 GenBank   WP_000130000
Name   Relaxase_p1002-1 insolico UniProt ID   Q0ZKT4
Length   101 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB Q0ZKT4


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 137497..165549

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CA268_RS27545 (CA268_27475) 133469..133903 + 435 WP_000845953 conjugation system SOS inhibitor PsiB -
CA268_RS27550 (CA268_27480) 133900..134662 + 763 Protein_150 plasmid SOS inhibition protein A -
CA268_RS30705 (CA268_27485) 134640..134819 - 180 WP_001309233 hypothetical protein -
CA268_RS31260 134841..134990 + 150 Protein_152 plasmid maintenance protein Mok -
CA268_RS27560 (CA268_27490) 134932..135057 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
CA268_RS30810 135376..135672 - 297 Protein_154 hypothetical protein -
CA268_RS27580 (CA268_27510) 135972..136268 + 297 WP_001272251 hypothetical protein -
CA268_RS27585 (CA268_27515) 136379..137200 + 822 WP_001234445 DUF932 domain-containing protein -
CA268_RS27590 (CA268_27520) 137497..138099 - 603 WP_000243713 transglycosylase SLT domain-containing protein virB1
CA268_RS27595 (CA268_27525) 138422..138805 + 384 WP_001354030 conjugal transfer relaxosome DNA-binding protein TraM -
CA268_RS27600 (CA268_27530) 138999..139670 + 672 WP_000283561 conjugal transfer transcriptional regulator TraJ -
CA268_RS27605 (CA268_27535) 139807..140034 + 228 WP_000089263 conjugal transfer relaxosome protein TraY -
CA268_RS27610 (CA268_27540) 140067..140425 + 359 Protein_161 type IV conjugative transfer system pilin TraA -
CA268_RS27615 (CA268_27545) 140440..140751 + 312 WP_000012113 type IV conjugative transfer system protein TraL traL
CA268_RS27620 (CA268_27550) 140773..141339 + 567 WP_000399780 type IV conjugative transfer system protein TraE traE
CA268_RS27625 (CA268_27555) 141326..142054 + 729 WP_001230772 type-F conjugative transfer system secretin TraK traK
CA268_RS27630 (CA268_27560) 142054..143505 + 1452 WP_000146675 F-type conjugal transfer pilus assembly protein TraB traB
CA268_RS27635 (CA268_27565) 143495..144061 + 567 WP_000896599 conjugal transfer pilus-stabilizing protein TraP -
CA268_RS27640 (CA268_27570) 144048..144368 + 321 WP_001057307 conjugal transfer protein TrbD -
CA268_RS27645 (CA268_27575) 144365..144880 + 516 WP_000809881 type IV conjugative transfer system lipoprotein TraV traV
CA268_RS27650 (CA268_27580) 145015..145236 + 222 WP_001278683 conjugal transfer protein TraR -
CA268_RS27655 (CA268_27585) 145229..145705 + 477 WP_000549587 hypothetical protein -
CA268_RS27660 (CA268_27590) 145785..146003 + 219 WP_000556745 hypothetical protein -
CA268_RS30370 146031..146378 + 348 WP_000836682 hypothetical protein -
CA268_RS27670 (CA268_27600) 146504..149134 + 2631 WP_000069777 type IV secretion system protein TraC virb4
CA268_RS27675 (CA268_27605) 149131..149517 + 387 WP_000214084 type-F conjugative transfer system protein TrbI -
CA268_RS27680 (CA268_27610) 149514..150146 + 633 WP_001203728 type-F conjugative transfer system protein TraW traW
CA268_RS27685 (CA268_27615) 150143..151135 + 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
CA268_RS27690 (CA268_27620) 151165..151470 + 306 WP_000224416 hypothetical protein -
CA268_RS27695 (CA268_27625) 151479..152117 + 639 WP_001080256 type-F conjugative transfer system pilin assembly protein TrbC trbC
CA268_RS27700 (CA268_27630) 152114..153964 + 1851 WP_000821856 type-F conjugative transfer system mating-pair stabilization protein TraN traN
CA268_RS27705 (CA268_27635) 153991..154248 + 258 WP_000864353 conjugal transfer protein TrbE -
CA268_RS27710 (CA268_27640) 154241..154984 + 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
CA268_RS27715 (CA268_27645) 154998..155342 + 345 WP_000556796 conjugal transfer protein TrbA -
CA268_RS27720 (CA268_27650) 155461..155745 + 285 WP_000624194 type-F conjugative transfer system pilin chaperone TraQ -
CA268_RS27725 (CA268_27655) 155732..156277 + 546 WP_000059831 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
CA268_RS27730 (CA268_27660) 156207..156554 + 348 WP_001309242 P-type conjugative transfer protein TrbJ -
CA268_RS27735 (CA268_27665) 156535..156927 + 393 WP_000660699 F-type conjugal transfer protein TrbF -
CA268_RS27740 (CA268_27670) 156914..158287 + 1374 WP_000944331 conjugal transfer pilus assembly protein TraH traH
CA268_RS27745 (CA268_27675) 158284..161106 + 2823 WP_086352862 conjugal transfer mating-pair stabilization protein TraG traG
CA268_RS27750 (CA268_27680) 161122..161607 + 486 WP_000605870 hypothetical protein -
CA268_RS27755 (CA268_27685) 161656..162387 + 732 WP_000782451 conjugal transfer complement resistance protein TraT -
CA268_RS27760 (CA268_27690) 162590..163327 + 738 WP_000199905 hypothetical protein -
CA268_RS27765 (CA268_27695) 163378..165549 + 2172 WP_023910159 type IV conjugative transfer system coupling protein TraD virb4


Host bacterium


ID   1412 GenBank   NZ_CP021203
Plasmid name   p1002-1 Incompatibility group   p0111
Plasmid size   183508 bp Coordinate of oriT [Strand]   137885..138434 [-]
Host baterium   Escherichia coli strain Z1002

Cargo genes


Drug resistance gene   tellurite/colicin resistance; tunicamycin resistance
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -