Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100949
Name   oriT_pKPN1482-3 in_silico
Organism   Klebsiella pneumoniae strain KPN1482
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP020844 (36393..36498 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKPN1482-3
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1019 GenBank   WP_004187323
Name   PutativerelaxaseofpKPN1482-3 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 39294..66592

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
B8O09_RS30430 (B8O09_30390) 34378..34689 + 312 WP_004187333 hypothetical protein -
B8O09_RS30435 (B8O09_30395) 34822..35358 + 537 WP_004187332 hypothetical protein -
B8O09_RS30440 (B8O09_30400) 35860..36255 - 396 WP_019725163 hypothetical protein -
B8O09_RS32145 36290..36817 + 528 WP_172740549 plasmid mobilization protein MobA -
B8O09_RS30450 (B8O09_30410) 36804..38783 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
B8O09_RS30455 (B8O09_30415) 38797..39297 + 501 WP_004187320 DotD/TraH family lipoprotein -
B8O09_RS30460 (B8O09_30420) 39294..40073 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
B8O09_RS30465 (B8O09_30425) 40084..41247 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
B8O09_RS30470 (B8O09_30430) 41237..41497 + 261 WP_004187310 IcmT/TraK family protein traK
B8O09_RS32150 41522..44959 + 3438 WP_015586048 LPD7 domain-containing protein -
B8O09_RS30480 (B8O09_30440) 44925..45437 + 513 WP_011091071 hypothetical protein traL
B8O09_RS30485 (B8O09_30445) 45438..45650 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
B8O09_RS30490 (B8O09_30450) 45622..46032 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
B8O09_RS30495 (B8O09_30455) 46100..46813 + 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
B8O09_RS30500 (B8O09_30460) 46822..47973 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
B8O09_RS30505 (B8O09_30465) 47985..49334 + 1350 WP_004187474 conjugal transfer protein TraO traO
B8O09_RS30510 (B8O09_30470) 49346..50050 + 705 WP_015060002 conjugal transfer protein TraP traP
B8O09_RS30515 (B8O09_30475) 50074..50604 + 531 WP_004187478 conjugal transfer protein TraQ traQ
B8O09_RS30520 (B8O09_30480) 50621..51010 + 390 WP_004187479 DUF6750 family protein traR
B8O09_RS30525 (B8O09_30485) 51056..51550 + 495 WP_004187480 hypothetical protein -
B8O09_RS30530 (B8O09_30490) 51547..54597 + 3051 WP_004187482 hypothetical protein traU
B8O09_RS30535 (B8O09_30495) 54594..55802 + 1209 WP_011091082 conjugal transfer protein TraW traW
B8O09_RS30540 (B8O09_30500) 55799..56395 + 597 WP_015060003 hypothetical protein -
B8O09_RS30545 (B8O09_30505) 56388..58583 + 2196 WP_015062834 DotA/TraY family protein traY
B8O09_RS30550 (B8O09_30510) 58585..59238 + 654 WP_015060005 hypothetical protein -
B8O09_RS30555 (B8O09_30515) 59319..59549 + 231 WP_011091085 IncL/M type plasmid replication protein RepC -
B8O09_RS30560 (B8O09_30520) 59845..60900 + 1056 WP_015060006 plasmid replication initiator RepA -
B8O09_RS32375 62123..62218 + 96 WP_004206884 DinQ-like type I toxin DqlB -
B8O09_RS30565 (B8O09_30525) 62269..64356 - 2088 WP_004206885 conjugal transfer protein TrbC -
B8O09_RS30570 (B8O09_30530) 64369..65319 - 951 WP_004206886 DsbC family protein trbB
B8O09_RS30575 (B8O09_30535) 65330..66592 - 1263 WP_004206887 hypothetical protein trbA
B8O09_RS30580 (B8O09_30540) 66637..67032 - 396 WP_004187436 lytic transglycosylase domain-containing protein -
B8O09_RS30585 (B8O09_30545) 67137..67520 - 384 WP_086893468 DUF1496 domain-containing protein -
B8O09_RS30590 (B8O09_30550) 67600..68034 + 435 Protein_86 CPBP family intramembrane glutamate endopeptidase -
B8O09_RS30595 (B8O09_30555) 68049..69254 - 1206 WP_025987686 IS4-like element IS10A family transposase -
B8O09_RS30610 (B8O09_30570) 70167..70964 + 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -


Host bacterium


ID   1407 GenBank   NZ_CP020844
Plasmid name   pKPN1482-3 Incompatibility group   IncL/M
Plasmid size   74177 bp Coordinate of oriT [Strand]   36393..36498 [+]
Host baterium   Klebsiella pneumoniae strain KPN1482

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -