Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 100940
• Name: oriT_pXI1
• Organism: Thiomonas intermedia strain ATCC 15466
• Sequence Completeness: incomplete
• NCBI accession of oriT (coordinates [strand]): NZ_CP020047 (29401..29442 [+], 42 nt)
• oriT length: 42 nt
• IRs (inverted repeats): _
• Location of nic site: 24..25
• Conserved sequence flanking the nic site: TATCCTG|C
• Note: predicted by the oriTfinder

oriT sequence

• Length: 42 nt

>oriT_pXI1
TATACCGGCGATTAGCCTATCCTGCAATAGCCCACACCCCCC

oriT secondary structure

Predicted by RNAfold.

Relaxase

PutativerelaxaseofpXI1

• ID: 1010
• GenBank: WP_079420795
• Name: PutativerelaxaseofpXI1
• UniProt ID: _
• Length: 364 a.a.
• Note: putative relaxase

Relaxase protein sequence

• Length: 364 a.a.
• Molecular weight: 40421.49 Da
• Isoelectric Point: 10.4863

>WP_079420795.1 relaxase/mobilization nuclease domain-containing protein [Thiomonas intermedia]
MSKTVIDGIIKDWGERLHYSPVKGSKGRNIRSGGTTRAAKPSPPSGPATKEKVARTAKKTAEVMVKISGG
GKNMKHIKAHMDYISRNGEVEIEDENGDIHQGMEAVRDVRDSWAKGKIGIPYEGEKRKEAFNIVLSMPPG
TDRQAVKDAAREFAKQEFGNHQYVFAAHDDEKHPHVHLAVKAVGNDGIRLNPRKGDLQYWREQFAEKLRD
QGIEANATPRRARGVVQKAEKQAVRHIDAEFQQGKRQEPARVTRARKQDAEAEVKTGKKRANPAQDNISA
ARKDTQKAYGQIARALATGEPEDKQIALNIVRLVQTMPPVVTKHDALVQSLRGTGGQTAERETEPKQPQR
QEQGRANPGDEQTR

Protein domains

Predicted by InterproScan.

• Relaxase/Mobilisation nuclease domain (Relaxase) (122-255)

Protein structure

No available structure.

T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 6097..19079

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BVH73_RS15365	1411..1635	-	225	WP_010991818	hypothetical protein	-
BVH73_RS15370	1654..1917	-	264	WP_154048552	hypothetical protein	-
BVH73_RS15375	1926..2192	-	267	WP_079420746	hypothetical protein	-
BVH73_RS15380	2347..2775	-	429	WP_079420748	hypothetical protein	-
BVH73_RS15385	2785..3054	-	270	WP_245800523	hypothetical protein	-
BVH73_RS15880	3078..3218	-	141	WP_012274961	hypothetical protein	-
BVH73_RS15390	3306..3572	-	267	WP_079420752	hypothetical protein	-
BVH73_RS15395	3681..4229	-	549	WP_079420755	hypothetical protein	-
BVH73_RS15400	4250..4552	-	303	WP_079420757	hypothetical protein	-
BVH73_RS15405	5644..6039	+	396	WP_179947983	hypothetical protein	-
BVH73_RS15410	6097..6858	+	762	WP_079420761	lytic transglycosylase domain-containing protein	virB1
BVH73_RS15415	6868..9183	+	2316	WP_079420763	type I DNA topoisomerase	-
BVH73_RS15420	9348..9656	+	309	WP_079420765	TrbC/VirB2 family protein	virB2
BVH73_RS15425	9678..9989	+	312	WP_238824245	VirB3 family type IV secretion system protein	virB3
BVH73_RS15430	9996..12476	+	2481	WP_079420767	VirB4 family type IV secretion/conjugal transfer ATPase	virb4
BVH73_RS15435	12488..13204	+	717	WP_079420769	P-type DNA transfer protein VirB5	virB5
BVH73_RS15440	13308..13604	+	297	WP_154048554	EexN family lipoprotein	-
BVH73_RS15445	13615..13896	+	282	WP_079420773	type IV secretion system protein	virB6
BVH73_RS15450	13900..14982	+	1083	WP_079420775	type IV secretion system protein	virB6
BVH73_RS15885	15119..15283	+	165	WP_154048555	conjugal transfer protein TraI	-
BVH73_RS15455	15289..15999	+	711	WP_079420777	VirB8/TrbF family protein	virB8
BVH73_RS15460	15996..16868	+	873	WP_079420779	P-type conjugative transfer protein VirB9	virB9
BVH73_RS15465	16868..18028	+	1161	WP_079420781	type IV secretion system protein VirB10	virB10
BVH73_RS15470	18012..19079	+	1068	WP_079420783	P-type DNA transfer ATPase VirB11	virB11
BVH73_RS15475	19627..22131	+	2505	WP_154048556	type IV secretory system conjugative DNA transfer family protein	-
BVH73_RS15480	22233..22928	+	696	WP_079420785	hypothetical protein	-

Host bacterium

• ID: 1398
• GenBank: NZ_CP020047
• Plasmid name: pXI1
• Incompatibility group: _
• Plasmid size: 42402 bp
• Coordinate of oriT [Strand]: 29401..29442 [+]
• Host baterium: Thiomonas intermedia strain ATCC 15466

Cargo genes

• Drug resistance gene: -
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -