Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100940 |
| Name | oriT_pXI1 |
| Organism | Thiomonas intermedia strain ATCC 15466 |
| Sequence Completeness | incomplete |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP020047 (29401..29442 [+], 42 nt) |
| oriT length | 42 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | 24..25 |
| Conserved sequence flanking the nic site |
TATCCTG|C |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 42 nt
>oriT_pXI1
TATACCGGCGATTAGCCTATCCTGCAATAGCCCACACCCCCC
TATACCGGCGATTAGCCTATCCTGCAATAGCCCACACCCCCC
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 1010 | GenBank | WP_079420795 |
| Name | PutativerelaxaseofpXI1 |
UniProt ID | _ |
| Length | 364 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 364 a.a. Molecular weight: 40421.49 Da Isoelectric Point: 10.4863
>WP_079420795.1 relaxase/mobilization nuclease domain-containing protein [Thiomonas intermedia]
MSKTVIDGIIKDWGERLHYSPVKGSKGRNIRSGGTTRAAKPSPPSGPATKEKVARTAKKTAEVMVKISGG
GKNMKHIKAHMDYISRNGEVEIEDENGDIHQGMEAVRDVRDSWAKGKIGIPYEGEKRKEAFNIVLSMPPG
TDRQAVKDAAREFAKQEFGNHQYVFAAHDDEKHPHVHLAVKAVGNDGIRLNPRKGDLQYWREQFAEKLRD
QGIEANATPRRARGVVQKAEKQAVRHIDAEFQQGKRQEPARVTRARKQDAEAEVKTGKKRANPAQDNISA
ARKDTQKAYGQIARALATGEPEDKQIALNIVRLVQTMPPVVTKHDALVQSLRGTGGQTAERETEPKQPQR
QEQGRANPGDEQTR
MSKTVIDGIIKDWGERLHYSPVKGSKGRNIRSGGTTRAAKPSPPSGPATKEKVARTAKKTAEVMVKISGG
GKNMKHIKAHMDYISRNGEVEIEDENGDIHQGMEAVRDVRDSWAKGKIGIPYEGEKRKEAFNIVLSMPPG
TDRQAVKDAAREFAKQEFGNHQYVFAAHDDEKHPHVHLAVKAVGNDGIRLNPRKGDLQYWREQFAEKLRD
QGIEANATPRRARGVVQKAEKQAVRHIDAEFQQGKRQEPARVTRARKQDAEAEVKTGKKRANPAQDNISA
ARKDTQKAYGQIARALATGEPEDKQIALNIVRLVQTMPPVVTKHDALVQSLRGTGGQTAERETEPKQPQR
QEQGRANPGDEQTR
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 6097..19079
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BVH73_RS15365 | 1411..1635 | - | 225 | WP_010991818 | hypothetical protein | - |
| BVH73_RS15370 | 1654..1917 | - | 264 | WP_154048552 | hypothetical protein | - |
| BVH73_RS15375 | 1926..2192 | - | 267 | WP_079420746 | hypothetical protein | - |
| BVH73_RS15380 | 2347..2775 | - | 429 | WP_079420748 | hypothetical protein | - |
| BVH73_RS15385 | 2785..3054 | - | 270 | WP_245800523 | hypothetical protein | - |
| BVH73_RS15880 | 3078..3218 | - | 141 | WP_012274961 | hypothetical protein | - |
| BVH73_RS15390 | 3306..3572 | - | 267 | WP_079420752 | hypothetical protein | - |
| BVH73_RS15395 | 3681..4229 | - | 549 | WP_079420755 | hypothetical protein | - |
| BVH73_RS15400 | 4250..4552 | - | 303 | WP_079420757 | hypothetical protein | - |
| BVH73_RS15405 | 5644..6039 | + | 396 | WP_179947983 | hypothetical protein | - |
| BVH73_RS15410 | 6097..6858 | + | 762 | WP_079420761 | lytic transglycosylase domain-containing protein | virB1 |
| BVH73_RS15415 | 6868..9183 | + | 2316 | WP_079420763 | type I DNA topoisomerase | - |
| BVH73_RS15420 | 9348..9656 | + | 309 | WP_079420765 | TrbC/VirB2 family protein | virB2 |
| BVH73_RS15425 | 9678..9989 | + | 312 | WP_238824245 | VirB3 family type IV secretion system protein | virB3 |
| BVH73_RS15430 | 9996..12476 | + | 2481 | WP_079420767 | VirB4 family type IV secretion/conjugal transfer ATPase | virb4 |
| BVH73_RS15435 | 12488..13204 | + | 717 | WP_079420769 | P-type DNA transfer protein VirB5 | virB5 |
| BVH73_RS15440 | 13308..13604 | + | 297 | WP_154048554 | EexN family lipoprotein | - |
| BVH73_RS15445 | 13615..13896 | + | 282 | WP_079420773 | type IV secretion system protein | virB6 |
| BVH73_RS15450 | 13900..14982 | + | 1083 | WP_079420775 | type IV secretion system protein | virB6 |
| BVH73_RS15885 | 15119..15283 | + | 165 | WP_154048555 | conjugal transfer protein TraI | - |
| BVH73_RS15455 | 15289..15999 | + | 711 | WP_079420777 | VirB8/TrbF family protein | virB8 |
| BVH73_RS15460 | 15996..16868 | + | 873 | WP_079420779 | P-type conjugative transfer protein VirB9 | virB9 |
| BVH73_RS15465 | 16868..18028 | + | 1161 | WP_079420781 | type IV secretion system protein VirB10 | virB10 |
| BVH73_RS15470 | 18012..19079 | + | 1068 | WP_079420783 | P-type DNA transfer ATPase VirB11 | virB11 |
| BVH73_RS15475 | 19627..22131 | + | 2505 | WP_154048556 | type IV secretory system conjugative DNA transfer family protein | - |
| BVH73_RS15480 | 22233..22928 | + | 696 | WP_079420785 | hypothetical protein | - |
Host bacterium
| ID | 1398 | GenBank | NZ_CP020047 |
| Plasmid name | pXI1 | Incompatibility group | _ |
| Plasmid size | 42402 bp | Coordinate of oriT [Strand] | 29401..29442 [+] |
| Host baterium | Thiomonas intermedia strain ATCC 15466 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |