Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100933 |
| Name | oriT_pASM2 |
| Organism | Enterobacter roggenkampii strain R11 |
| Sequence Completeness | core |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP019841 (11351..11455 [-], 105 nt) |
| oriT length | 105 nt |
| IRs (inverted repeats) | 18..35, 42..59 (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 105 nt
>oriT_pASM2
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 1004 | GenBank | WP_004206924 |
| Name | PutativerelaxaseofpASM2 |
UniProt ID | _ |
| Length | 659 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 659 a.a. Molecular weight: 75087.84 Da Isoelectric Point: 10.0285
>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 6..8553
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B1H21_RS23650 (B1H21_23935) | 6..1157 | - | 1152 | WP_015062843 | DotH/IcmK family type IV secretion protein | traN |
| B1H21_RS23655 (B1H21_23940) | 1166..1879 | - | 714 | WP_223294958 | DotI/IcmL family type IV secretion protein | traM |
| B1H21_RS23660 (B1H21_23945) | 1947..2357 | + | 411 | WP_004187465 | H-NS family nucleoid-associated regulatory protein | - |
| B1H21_RS23665 (B1H21_23950) | 2386..2541 | + | 156 | WP_172693602 | Hha/YmoA family nucleoid-associated regulatory protein | - |
| B1H21_RS23670 (B1H21_23955) | 2542..3054 | - | 513 | WP_011091071 | hypothetical protein | traL |
| B1H21_RS25090 | 3020..6325 | - | 3306 | WP_219818010 | LPD7 domain-containing protein | - |
| B1H21_RS23680 (B1H21_23965) | 6350..6610 | - | 261 | WP_004187310 | IcmT/TraK family protein | traK |
| B1H21_RS23685 (B1H21_23970) | 6600..7763 | - | 1164 | WP_004206926 | plasmid transfer ATPase TraJ | virB11 |
| B1H21_RS23690 (B1H21_23975) | 7774..8553 | - | 780 | WP_004187315 | type IV secretory system conjugative DNA transfer family protein | traI |
| B1H21_RS23695 (B1H21_23980) | 8550..9050 | - | 501 | WP_004206925 | DotD/TraH family lipoprotein | - |
| B1H21_RS23700 (B1H21_23985) | 9064..11043 | - | 1980 | WP_004206924 | TraI/MobA(P) family conjugative relaxase | - |
| B1H21_RS23705 (B1H21_23990) | 11030..11347 | - | 318 | WP_004206923 | plasmid mobilization protein MobA | - |
| B1H21_RS23710 (B1H21_23995) | 11623..11988 | + | 366 | WP_004206922 | hypothetical protein | - |
| B1H21_RS23715 (B1H21_24000) | 12489..13025 | - | 537 | WP_004206920 | hypothetical protein | - |
| B1H21_RS23720 (B1H21_24005) | 13158..13469 | - | 312 | WP_004187333 | hypothetical protein | - |
Region 2: 60406..79095
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B1H21_RS24025 (B1H21_24320) | 55774..55992 | + | 219 | WP_004187411 | hypothetical protein | - |
| B1H21_RS24030 (B1H21_24325) | 55995..56204 | + | 210 | WP_004187413 | hypothetical protein | - |
| B1H21_RS24035 (B1H21_24330) | 56327..57592 | - | 1266 | WP_024190314 | translesion error-prone DNA polymerase V subunit UmuC | - |
| B1H21_RS24040 (B1H21_24335) | 57580..58014 | - | 435 | WP_044068898 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| B1H21_RS24045 (B1H21_24340) | 58107..58439 | - | 333 | WP_004187427 | type II toxin-antitoxin system toxin endoribonuclease PemK-mt | - |
| B1H21_RS24050 (B1H21_24345) | 58441..58698 | - | 258 | WP_004187429 | type II toxin-antitoxin system antitoxin PemI | - |
| B1H21_RS24055 (B1H21_24350) | 58790..59443 | - | 654 | WP_004206890 | type II CAAX endopeptidase family protein | - |
| B1H21_RS24060 (B1H21_24355) | 59523..59906 | + | 384 | WP_004206889 | DUF1496 domain-containing protein | - |
| B1H21_RS24065 (B1H21_24360) | 60011..60406 | + | 396 | WP_004187436 | lytic transglycosylase domain-containing protein | - |
| B1H21_RS24070 (B1H21_24365) | 60406..61713 | + | 1308 | WP_015059988 | hypothetical protein | trbA |
| B1H21_RS24075 (B1H21_24370) | 61724..62674 | + | 951 | WP_004206886 | DsbC family protein | trbB |
| B1H21_RS24080 (B1H21_24375) | 62687..64774 | + | 2088 | WP_004206885 | conjugal transfer protein TrbC | - |
| B1H21_RS25155 | 64825..64920 | - | 96 | WP_004206884 | DinQ-like type I toxin DqlB | - |
| B1H21_RS24085 (B1H21_24380) | 66147..67202 | - | 1056 | WP_021526650 | plasmid replication initiator RepA | - |
| B1H21_RS24090 (B1H21_24385) | 67499..67729 | - | 231 | WP_004187496 | IncL/M type plasmid replication protein RepC | - |
| B1H21_RS24095 (B1H21_24390) | 67803..68456 | - | 654 | WP_004206935 | hypothetical protein | - |
| B1H21_RS24100 (B1H21_24395) | 68459..70639 | - | 2181 | WP_004187492 | DotA/TraY family protein | traY |
| B1H21_RS24105 (B1H21_24400) | 70632..71282 | - | 651 | WP_004187488 | hypothetical protein | - |
| B1H21_RS24110 (B1H21_24405) | 71279..72487 | - | 1209 | WP_004187486 | conjugal transfer protein TraW | traW |
| B1H21_RS24115 (B1H21_24410) | 72484..75534 | - | 3051 | WP_011154474 | conjugative transfer protein | traU |
| B1H21_RS24120 (B1H21_24415) | 75531..76025 | - | 495 | WP_004187480 | hypothetical protein | - |
| B1H21_RS24125 (B1H21_24420) | 76071..76460 | - | 390 | WP_011154472 | DUF6750 family protein | traR |
| B1H21_RS24130 (B1H21_24425) | 76477..77007 | - | 531 | WP_004187478 | conjugal transfer protein TraQ | traQ |
| B1H21_RS24135 (B1H21_24430) | 77031..77735 | - | 705 | WP_004206933 | conjugal transfer protein TraP | traP |
| B1H21_RS24140 (B1H21_24435) | 77747..78898 | - | 1152 | WP_341350647 | conjugal transfer protein TraO | traO |
| B1H21_RS25095 | 78892..79095 | - | 204 | WP_242663228 | hypothetical protein | traO |
Host bacterium
| ID | 1392 | GenBank | NZ_CP019841 |
| Plasmid name | pASM2 | Incompatibility group | IncL/M |
| Plasmid size | 79101 bp | Coordinate of oriT [Strand] | 11351..11455 [-] |
| Host baterium | Enterobacter roggenkampii strain R11 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |