Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100928
Name   oriT_pCFSAN004174 in_silico
Organism   Salmonella enterica subsp. enterica serovar Saintpaul strain CFSAN004174
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP019207 (27278..27387 [+], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pCFSAN004174
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   999 GenBank   WP_076033867
Name   NikB_pCFSAN004174 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104039.45 Da        Isoelectric Point: 7.3426

>WP_076033867.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDVFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 2782..21917

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BKQ23_RS23965 (BKQ23_23965) 2782..3129 + 348 WP_001055900 conjugal transfer protein traL
BKQ23_RS23970 (BKQ23_23970) 3126..3818 + 693 WP_000138551 DotI/IcmL family type IV secretion protein traM
BKQ23_RS23975 (BKQ23_23975) 3829..4812 + 984 WP_001191880 IncI1-type conjugal transfer protein TraN traN
BKQ23_RS23980 (BKQ23_23980) 4815..6104 + 1290 WP_023196135 conjugal transfer protein TraO traO
BKQ23_RS23985 (BKQ23_23985) 6104..6808 + 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
BKQ23_RS23990 (BKQ23_23990) 6808..7335 + 528 WP_001055569 conjugal transfer protein TraQ traQ
BKQ23_RS23995 (BKQ23_23995) 7386..7790 + 405 WP_001422824 IncI1-type conjugal transfer protein TraR traR
BKQ23_RS24000 (BKQ23_24000) 7854..8042 + 189 WP_001277253 putative conjugal transfer protein TraS -
BKQ23_RS24005 (BKQ23_24005) 8026..8826 + 801 WP_001164783 IncI1-type conjugal transfer protein TraT traT
BKQ23_RS24010 (BKQ23_24010) 8916..11960 + 3045 WP_021265678 IncI1-type conjugal transfer protein TraU traU
BKQ23_RS24015 (BKQ23_24015) 11960..12574 + 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
BKQ23_RS24020 (BKQ23_24020) 12541..13743 + 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
BKQ23_RS24025 (BKQ23_24025) 13772..14356 + 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
BKQ23_RS24030 (BKQ23_24030) 14453..16621 + 2169 WP_000698357 DotA/TraY family protein traY
BKQ23_RS24035 (BKQ23_24035) 16695..17345 + 651 WP_001178506 plasmid IncI1-type surface exclusion protein ExcA -
BKQ23_RS24040 (BKQ23_24040) 17417..17626 - 210 WP_000062603 HEAT repeat domain-containing protein -
BKQ23_RS25240 18018..18194 + 177 WP_001054904 hypothetical protein -
BKQ23_RS25560 18259..18354 - 96 WP_000609148 DinQ-like type I toxin DqlB -
BKQ23_RS24045 (BKQ23_24045) 18853..19104 + 252 WP_001291964 hypothetical protein -
BKQ23_RS24050 (BKQ23_24050) 19176..19328 - 153 WP_001303307 Hok/Gef family protein -
BKQ23_RS24055 (BKQ23_24055) 19620..20828 + 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
BKQ23_RS24060 (BKQ23_24060) 20847..21917 + 1071 WP_001749135 IncI1-type conjugal transfer protein TrbB trbB
BKQ23_RS25460 (BKQ23_24065) 21910..24202 + 2293 Protein_23 F-type conjugative transfer protein TrbC -

Region 2: 67552..79754

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BKQ23_RS24385 (BKQ23_24385) 62614..63681 + 1068 WP_001545759 type IV pilus biogenesis lipoprotein PilL -
BKQ23_RS24390 (BKQ23_24390) 63681..64118 + 438 WP_001545758 type IV pilus biogenesis protein PilM -
BKQ23_RS24395 (BKQ23_24395) 64132..65814 + 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
BKQ23_RS24400 (BKQ23_24400) 65807..67102 + 1296 WP_016245572 type 4b pilus protein PilO2 -
BKQ23_RS24405 (BKQ23_24405) 67089..67541 + 453 WP_001247333 type IV pilus biogenesis protein PilP -
BKQ23_RS24410 (BKQ23_24410) 67552..69105 + 1554 WP_001545756 ATPase, T2SS/T4P/T4SS family virB11
BKQ23_RS24415 (BKQ23_24415) 69118..70203 + 1086 WP_001208802 type II secretion system F family protein -
BKQ23_RS24420 (BKQ23_24420) 70220..70834 + 615 WP_000908227 type 4 pilus major pilin -
BKQ23_RS24425 (BKQ23_24425) 70844..71404 + 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
BKQ23_RS24430 (BKQ23_24430) 71389..72045 + 657 WP_001193549 A24 family peptidase -
BKQ23_RS24435 (BKQ23_24435) 72045..73337 + 1293 WP_024145563 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BKQ23_RS24440 (BKQ23_24440) 73394..73651 - 258 Protein_84 transposase -
BKQ23_RS25615 73655..73747 + 93 Protein_85 shufflon-specific DNA recombinase -
BKQ23_RS24450 (BKQ23_24450) 73898..74722 + 825 WP_076033864 conjugal transfer protein TraE traE
BKQ23_RS24455 (BKQ23_24455) 74808..76010 + 1203 WP_023196138 conjugal transfer protein TraF -
BKQ23_RS24460 (BKQ23_24460) 76070..76654 + 585 WP_001611722 histidine phosphatase family protein -
BKQ23_RS24465 (BKQ23_24465) 77049..77507 + 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
BKQ23_RS24470 (BKQ23_24470) 77504..78322 + 819 WP_076033865 IncI1-type conjugal transfer lipoprotein TraI traI
BKQ23_RS24475 (BKQ23_24475) 78319..79467 + 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
BKQ23_RS24480 (BKQ23_24480) 79464..79754 + 291 WP_001314267 hypothetical protein traK
BKQ23_RS24485 (BKQ23_24485) 79769..80320 + 552 WP_000014586 phospholipase D family protein -


Host bacterium


ID   1387 GenBank   NZ_CP019207
Plasmid name   pCFSAN004174 Incompatibility group   IncI1
Plasmid size   81410 bp Coordinate of oriT [Strand]   27278..27387 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Saintpaul strain CFSAN004174

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -