Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100927
Name   oriT_pCFSAN004173 in_silico
Organism   Salmonella enterica subsp. enterica serovar Saintpaul strain CFSAN004173
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP019205 (76489..76598 [-], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pCFSAN004173
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   998 GenBank   WP_076033867
Name   NikB_pCFSAN004173 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104039.45 Da        Isoelectric Point: 7.3426

>WP_076033867.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDVFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 549..36324

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BKQ24_RS23965 (BKQ24_23965) 549..1619 - 1071 WP_001749135 IncI1-type conjugal transfer protein TrbB trbB
BKQ24_RS23970 (BKQ24_23970) 1638..2846 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
BKQ24_RS23975 (BKQ24_23975) 3138..3290 + 153 WP_001303307 Hok/Gef family protein -
BKQ24_RS23980 (BKQ24_23980) 3362..3613 - 252 WP_001291964 hypothetical protein -
BKQ24_RS25560 4112..4207 + 96 WP_000609148 DinQ-like type I toxin DqlB -
BKQ24_RS25245 4272..4448 - 177 WP_001054904 hypothetical protein -
BKQ24_RS23985 (BKQ24_23985) 4840..5049 + 210 WP_000062603 HEAT repeat domain-containing protein -
BKQ24_RS23990 (BKQ24_23990) 5121..5771 - 651 WP_001178506 plasmid IncI1-type surface exclusion protein ExcA -
BKQ24_RS23995 (BKQ24_23995) 5845..8013 - 2169 WP_000698357 DotA/TraY family protein traY
BKQ24_RS24000 (BKQ24_24000) 8110..8694 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
BKQ24_RS24005 (BKQ24_24005) 8723..9925 - 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
BKQ24_RS24010 (BKQ24_24010) 9892..10506 - 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
BKQ24_RS24015 (BKQ24_24015) 10506..13550 - 3045 WP_021265678 IncI1-type conjugal transfer protein TraU traU
BKQ24_RS24020 (BKQ24_24020) 13640..14440 - 801 WP_001164783 IncI1-type conjugal transfer protein TraT traT
BKQ24_RS24025 (BKQ24_24025) 14424..14612 - 189 WP_001277253 putative conjugal transfer protein TraS -
BKQ24_RS24030 (BKQ24_24030) 14676..15080 - 405 WP_001422824 IncI1-type conjugal transfer protein TraR traR
BKQ24_RS24035 (BKQ24_24035) 15131..15658 - 528 WP_001055569 conjugal transfer protein TraQ traQ
BKQ24_RS24040 (BKQ24_24040) 15658..16362 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
BKQ24_RS24045 (BKQ24_24045) 16362..17651 - 1290 WP_023196135 conjugal transfer protein TraO traO
BKQ24_RS24050 (BKQ24_24050) 17654..18637 - 984 WP_001191880 IncI1-type conjugal transfer protein TraN traN
BKQ24_RS24055 (BKQ24_24055) 18648..19340 - 693 WP_000138551 DotI/IcmL family type IV secretion protein traM
BKQ24_RS24060 (BKQ24_24060) 19337..19684 - 348 WP_001055900 conjugal transfer protein traL
BKQ24_RS24065 (BKQ24_24065) 19702..23466 - 3765 WP_076033866 LPD7 domain-containing protein -
BKQ24_RS24070 (BKQ24_24070) 23556..24107 - 552 WP_000014586 phospholipase D family protein -
BKQ24_RS24075 (BKQ24_24075) 24122..24412 - 291 WP_001314267 hypothetical protein traK
BKQ24_RS24080 (BKQ24_24080) 24409..25557 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
BKQ24_RS24085 (BKQ24_24085) 25554..26372 - 819 WP_076033865 IncI1-type conjugal transfer lipoprotein TraI traI
BKQ24_RS24090 (BKQ24_24090) 26369..26827 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
BKQ24_RS24095 (BKQ24_24095) 27222..27806 - 585 WP_001611722 histidine phosphatase family protein -
BKQ24_RS24100 (BKQ24_24100) 27866..29068 - 1203 WP_023196138 conjugal transfer protein TraF -
BKQ24_RS24105 (BKQ24_24105) 29154..29978 - 825 WP_076033864 conjugal transfer protein TraE traE
BKQ24_RS25605 30129..30221 - 93 Protein_32 shufflon-specific DNA recombinase -
BKQ24_RS24115 (BKQ24_24115) 30225..30482 + 258 Protein_33 transposase -
BKQ24_RS24120 (BKQ24_24120) 30539..31831 - 1293 WP_024145563 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BKQ24_RS24125 (BKQ24_24125) 31831..32487 - 657 WP_001193549 A24 family peptidase -
BKQ24_RS24130 (BKQ24_24130) 32472..33032 - 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
BKQ24_RS24135 (BKQ24_24135) 33042..33656 - 615 WP_000908227 type 4 pilus major pilin -
BKQ24_RS24140 (BKQ24_24140) 33673..34758 - 1086 WP_001208802 type II secretion system F family protein -
BKQ24_RS24145 (BKQ24_24145) 34771..36324 - 1554 WP_001545756 ATPase, T2SS/T4P/T4SS family virB11
BKQ24_RS24150 (BKQ24_24150) 36335..36787 - 453 WP_001247333 type IV pilus biogenesis protein PilP -
BKQ24_RS24155 (BKQ24_24155) 36774..38069 - 1296 WP_016245572 type 4b pilus protein PilO2 -
BKQ24_RS24160 (BKQ24_24160) 38062..39744 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
BKQ24_RS24165 (BKQ24_24165) 39758..40195 - 438 WP_001545758 type IV pilus biogenesis protein PilM -
BKQ24_RS24170 (BKQ24_24170) 40195..41262 - 1068 WP_001545759 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   1386 GenBank   NZ_CP019205
Plasmid name   pCFSAN004173 Incompatibility group   IncI1
Plasmid size   81408 bp Coordinate of oriT [Strand]   76489..76598 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Saintpaul strain CFSAN004173

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -