Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100925
Name   oriT_pCFSAN004175 in_silico
Organism   Salmonella enterica subsp. enterica serovar Saintpaul strain CFSAN004175
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP019173 (67516..67625 [+], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pCFSAN004175
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   996 GenBank   WP_076033867
Name   NikB_pCFSAN004175 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104039.45 Da        Isoelectric Point: 7.3426

>WP_076033867.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDVFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 26381..62156

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BKQ22_RS24140 (BKQ22_24140) 21443..22510 + 1068 WP_001545759 type IV pilus biogenesis lipoprotein PilL -
BKQ22_RS24145 (BKQ22_24145) 22510..22947 + 438 WP_001545758 type IV pilus biogenesis protein PilM -
BKQ22_RS24150 (BKQ22_24150) 22961..24643 + 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
BKQ22_RS24155 (BKQ22_24155) 24636..25931 + 1296 WP_016245572 type 4b pilus protein PilO2 -
BKQ22_RS24160 (BKQ22_24160) 25918..26370 + 453 WP_001247333 type IV pilus biogenesis protein PilP -
BKQ22_RS24165 (BKQ22_24165) 26381..27934 + 1554 WP_001545756 ATPase, T2SS/T4P/T4SS family virB11
BKQ22_RS24170 (BKQ22_24170) 27947..29032 + 1086 WP_001208802 type II secretion system F family protein -
BKQ22_RS24175 (BKQ22_24175) 29049..29663 + 615 WP_000908227 type 4 pilus major pilin -
BKQ22_RS24180 (BKQ22_24180) 29673..30233 + 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
BKQ22_RS24185 (BKQ22_24185) 30218..30874 + 657 WP_001193549 A24 family peptidase -
BKQ22_RS24190 (BKQ22_24190) 30874..32166 + 1293 WP_024145563 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BKQ22_RS24195 (BKQ22_24195) 32223..32480 - 258 Protein_38 transposase -
BKQ22_RS25575 32484..32576 + 93 Protein_39 shufflon-specific DNA recombinase -
BKQ22_RS24205 (BKQ22_24205) 32727..33551 + 825 WP_076033864 conjugal transfer protein TraE traE
BKQ22_RS24210 (BKQ22_24210) 33637..34839 + 1203 WP_023196138 conjugal transfer protein TraF -
BKQ22_RS24215 (BKQ22_24215) 34899..35483 + 585 WP_001611722 histidine phosphatase family protein -
BKQ22_RS24220 (BKQ22_24220) 35878..36336 + 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
BKQ22_RS24225 (BKQ22_24225) 36333..37151 + 819 WP_076033865 IncI1-type conjugal transfer lipoprotein TraI traI
BKQ22_RS24230 (BKQ22_24230) 37148..38296 + 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
BKQ22_RS24235 (BKQ22_24235) 38293..38583 + 291 WP_001314267 hypothetical protein traK
BKQ22_RS24240 (BKQ22_24240) 38598..39149 + 552 WP_000014586 phospholipase D family protein -
BKQ22_RS24245 (BKQ22_24245) 39239..43003 + 3765 WP_076033866 LPD7 domain-containing protein -
BKQ22_RS24250 (BKQ22_24250) 43021..43368 + 348 WP_001055900 conjugal transfer protein traL
BKQ22_RS24255 (BKQ22_24255) 43365..44057 + 693 WP_000138551 DotI/IcmL family type IV secretion protein traM
BKQ22_RS24260 (BKQ22_24260) 44068..45051 + 984 WP_001191880 IncI1-type conjugal transfer protein TraN traN
BKQ22_RS24265 (BKQ22_24265) 45054..46343 + 1290 WP_023196135 conjugal transfer protein TraO traO
BKQ22_RS24270 (BKQ22_24270) 46343..47047 + 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
BKQ22_RS24275 (BKQ22_24275) 47047..47574 + 528 WP_001055569 conjugal transfer protein TraQ traQ
BKQ22_RS24280 (BKQ22_24280) 47625..48029 + 405 WP_001422824 IncI1-type conjugal transfer protein TraR traR
BKQ22_RS24285 (BKQ22_24285) 48093..48281 + 189 WP_001277253 putative conjugal transfer protein TraS -
BKQ22_RS24290 (BKQ22_24290) 48265..49065 + 801 WP_001164783 IncI1-type conjugal transfer protein TraT traT
BKQ22_RS24295 (BKQ22_24295) 49155..52199 + 3045 WP_021265678 IncI1-type conjugal transfer protein TraU traU
BKQ22_RS24300 (BKQ22_24300) 52199..52813 + 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
BKQ22_RS24305 (BKQ22_24305) 52780..53982 + 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
BKQ22_RS24310 (BKQ22_24310) 54011..54595 + 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
BKQ22_RS24315 (BKQ22_24315) 54692..56860 + 2169 WP_000698357 DotA/TraY family protein traY
BKQ22_RS24320 (BKQ22_24320) 56934..57584 + 651 WP_001178506 plasmid IncI1-type surface exclusion protein ExcA -
BKQ22_RS24325 (BKQ22_24325) 57656..57865 - 210 WP_000062603 HEAT repeat domain-containing protein -
BKQ22_RS25245 58257..58433 + 177 WP_001054904 hypothetical protein -
BKQ22_RS25525 58498..58593 - 96 WP_000609148 DinQ-like type I toxin DqlB -
BKQ22_RS24330 (BKQ22_24330) 59092..59343 + 252 WP_001291964 hypothetical protein -
BKQ22_RS24335 (BKQ22_24335) 59415..59567 - 153 WP_001303307 Hok/Gef family protein -
BKQ22_RS24340 (BKQ22_24340) 59859..61067 + 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
BKQ22_RS24345 (BKQ22_24345) 61086..62156 + 1071 WP_001749135 IncI1-type conjugal transfer protein TrbB trbB
BKQ22_RS24350 (BKQ22_24350) 62149..64440 + 2292 WP_001289276 F-type conjugative transfer protein TrbC -


Host bacterium


ID   1384 GenBank   NZ_CP019173
Plasmid name   pCFSAN004175 Incompatibility group   IncI1
Plasmid size   81409 bp Coordinate of oriT [Strand]   67516..67625 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Saintpaul strain CFSAN004175

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -