Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100923
Name   oriT_pEC244_2 in_silico
Organism   Escherichia coli strain Ecol_244
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP019018 (105284..105573 [+], 290 nt)
oriT length   290 nt
IRs (inverted repeats)      225..232, 235..242 n  (GCAAAAAC..GTTTTTGC)
Location of nic site      251..252
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 290 nt

>oriT_pEC244_2
CGCACCGCTAGCAGCGCCCCTAGCGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGTTGTAGCCTCGCCGACACCGCTTTTTTAAATATCATAAAGAGAGTAAGAGAAACTAATTTTTCATAACTCTCTATTTATAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   994 GenBank   WP_001611029
Name   TraI_pEC244_2 insolico UniProt ID   A0A075MCD1
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 191983.83 Da        Isoelectric Point: 5.9594

>WP_001611029.1 MULTISPECIES: conjugative transfer relaxase/helicase TraI [Enterobacteriaceae]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGKLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSVMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAETRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMAFTPGNTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGLPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPASLPVSDSPFTALKL
ENGWVETPGHSVSDSAKVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETLLETAISLQKAGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTSFIDLGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWVPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALALVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRECGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKQMTGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKSDREVMNAERLFSTARELRDVVAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPRTITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVRDIAGLERDRSAISEREAALPESVLREPQRVREAVREVARENLLQERLQQMERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)

AAA domain (AAA_30)

(969-1156)

TrwC relaxase (TrwC)

(10-283)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-625)

DNA helicase TraI (TraI_C)

(1434-1557)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 79690..106135

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BE937_RS01160 (BE937_01230) 79056..79283 + 228 WP_000450520 toxin-antitoxin system antitoxin VapB -
BE937_RS01165 (BE937_01235) 79283..79681 + 399 WP_000911313 type II toxin-antitoxin system VapC family toxin -
BE937_RS01170 (BE937_01240) 79690..81915 - 2226 WP_064237182 type IV conjugative transfer system coupling protein TraD virb4
BE937_RS01175 (BE937_01245) 82168..82899 - 732 WP_023565183 conjugal transfer complement resistance protein TraT -
BE937_RS01180 (BE937_01250) 82931..83428 - 498 WP_000605857 entry exclusion protein -
BE937_RS01185 (BE937_01255) 83444..86266 - 2823 WP_001007018 conjugal transfer mating-pair stabilization protein TraG traG
BE937_RS01190 (BE937_01260) 86263..87636 - 1374 WP_001517790 conjugal transfer pilus assembly protein TraH traH
BE937_RS01195 (BE937_01265) 87636..88016 - 381 WP_001680290 F-type conjugal transfer protein TrbF -
BE937_RS01200 (BE937_01270) 88003..88344 - 342 WP_001443031 P-type conjugative transfer protein TrbJ -
BE937_RS01205 (BE937_01275) 88274..88819 - 546 WP_001680291 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
BE937_RS01210 (BE937_01280) 88806..89090 - 285 WP_000624109 type-F conjugative transfer system pilin chaperone TraQ -
BE937_RS01215 (BE937_01285) 89171..89485 + 315 WP_000415566 protein ArtA -
BE937_RS01220 (BE937_01290) 89487..89834 - 348 WP_001287910 conjugal transfer protein TrbA -
BE937_RS01225 (BE937_01295) 89850..90593 - 744 WP_001680292 type-F conjugative transfer system pilin assembly protein TraF traF
BE937_RS01230 (BE937_01300) 90586..90843 - 258 WP_000864318 conjugal transfer protein TrbE -
BE937_RS01235 (BE937_01305) 90870..92678 - 1809 WP_000821849 type-F conjugative transfer system mating-pair stabilization protein TraN traN
BE937_RS01240 (BE937_01310) 92675..93313 - 639 WP_000777695 type-F conjugative transfer system pilin assembly protein TrbC trbC
BE937_RS01245 (BE937_01315) 93322..94314 - 993 WP_000830180 conjugal transfer pilus assembly protein TraU traU
BE937_RS01250 (BE937_01320) 94311..94943 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
BE937_RS01255 (BE937_01325) 94940..95326 - 387 WP_001680293 type-F conjugative transfer system protein TrbI -
BE937_RS01260 (BE937_01330) 95323..97950 - 2628 WP_001064245 type IV secretion system protein TraC virb4
BE937_RS01265 (BE937_01335) 98110..98331 - 222 WP_001278689 conjugal transfer protein TraR -
BE937_RS01270 (BE937_01340) 98466..98981 - 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
BE937_RS01275 (BE937_01345) 98978..99229 - 252 WP_001038342 conjugal transfer protein TrbG -
BE937_RS01280 (BE937_01350) 99241..99438 - 198 WP_001324648 conjugal transfer protein TrbD -
BE937_RS01285 (BE937_01355) 99425..100015 - 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
BE937_RS01290 (BE937_01360) 100005..101432 - 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
BE937_RS01295 (BE937_01365) 101432..102160 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
BE937_RS01300 (BE937_01370) 102147..102713 - 567 WP_000399792 type IV conjugative transfer system protein TraE traE
BE937_RS01305 (BE937_01375) 102735..103046 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
BE937_RS01310 (BE937_01380) 103061..103426 - 366 WP_000994779 type IV conjugative transfer system pilin TraA -
BE937_RS01315 (BE937_01385) 103459..103854 - 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
BE937_RS01320 (BE937_01390) 103953..104642 - 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
BE937_RS01325 (BE937_01395) 104829..105212 - 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
BE937_RS01330 (BE937_01400) 105545..106135 + 591 WP_279947734 transglycosylase SLT domain-containing protein virB1
BE937_RS01335 (BE937_01405) 106432..107253 - 822 WP_001234487 DUF932 domain-containing protein -
BE937_RS01340 (BE937_01410) 107364..107660 - 297 WP_001272245 hypothetical protein -
BE937_RS28830 107712..107985 + 274 Protein_112 hypothetical protein -
BE937_RS01350 (BE937_01420) 108286..108411 - 126 WP_096937776 type I toxin-antitoxin system Hok family toxin -
BE937_RS28835 108353..108502 - 150 Protein_114 plasmid maintenance protein Mok -
BE937_RS01355 (BE937_01430) 108681..109443 - 763 Protein_115 plasmid SOS inhibition protein A -
BE937_RS01360 (BE937_01435) 109440..109874 - 435 WP_000845962 conjugation system SOS inhibitor PsiB -

Host bacterium

ID   1382 GenBank   NZ_CP019018
Plasmid name   pEC244_2 Incompatibility group   IncFIB
Plasmid size   158911 bp Coordinate of oriT [Strand]   105284..105573 [+]
Host baterium   Escherichia coli strain Ecol_244

Cargo genes

Drug resistance gene   sitABCD
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -