Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100922
Name   oriT_pECAZ159_1 in_silico
Organism   Escherichia coli strain Ecol_AZ159
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP019007 (12694..12983 [-], 290 nt)
oriT length   290 nt
IRs (inverted repeats)      225..232, 235..242 n  (GCAAAAAC..GTTTTTGC)
Location of nic site      251..252
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 290 nt

>oriT_pECAZ159_1
CGCACCGCTAGCAGCGCCCCTAGCGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCCCCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAACGGTGTCGGCGCGTTGTTGTAGCCGCGCCGACACCGCTTTTTTAAATATCATAAAGAGAGTAAGAGAAACTAATTTTTCATAACACTCTATTTATAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   993 GenBank   WP_011117356
Name   TraI_pECAZ159_1 insolico UniProt ID   Q84A21
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 192202.14 Da        Isoelectric Point: 5.9371

>WP_011117356.1 MULTISPECIES: conjugative transfer relaxase/helicase TraI [Gammaproteobacteria]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNRHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIREAVGEDASLKSRDVAALDTRKSKQHVDPEIKMVEWMQT
LKETGFDIRAYRDAADQRADLRTLTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNMKQDERLSGELITGR
RQLLEGMTFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLIIDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAVSVKAGEESVAQVSGVREQAMLTQTIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVSSVSEDAMTVVVPGRAEPATLPVSDSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KTRAGETSLETAISHQKSALHTPAQQAIHLALPVVESKKLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVMPLMERVPGELMEKLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDVREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALVLVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTREIRPGQEQAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVF
EPKPDREVMNAERLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVREIAGQERDRAAITEREAALPEGVLREPQRVREAVREIARENLLQERLQQMERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

TrwC relaxase (TrwC)

(10-283)

AAA domain (AAA_30)

(969-1156)

DNA helicase TraI (TraI_C)

(1434-1557)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-626)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 12132..38534

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BE939_RS00410 (BE939_00405) 8096..8530 + 435 WP_000845895 conjugation system SOS inhibitor PsiB -
BE939_RS00415 (BE939_00410) 8527..9289 + 763 Protein_13 plasmid SOS inhibition protein A -
BE939_RS26265 (BE939_00415) 9258..9446 - 189 WP_001299721 hypothetical protein -
BE939_RS26960 9468..9617 + 150 Protein_15 plasmid maintenance protein Mok -
BE939_RS00420 (BE939_00420) 9559..9684 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
BE939_RS26965 (BE939_00425) 9904..10134 + 231 WP_001426396 hypothetical protein -
BE939_RS26970 10132..10305 - 174 Protein_18 hypothetical protein -
BE939_RS26670 (BE939_00435) 10375..10581 + 207 WP_000547939 hypothetical protein -
BE939_RS00445 (BE939_00440) 10606..10893 + 288 WP_078232962 hypothetical protein -
BE939_RS00450 (BE939_00445) 11014..11835 + 822 WP_001234469 DUF932 domain-containing protein -
BE939_RS00455 (BE939_00450) 12132..12722 - 591 WP_000252680 transglycosylase SLT domain-containing protein virB1
BE939_RS00460 (BE939_00455) 13055..13438 + 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
BE939_RS00465 (BE939_00460) 13625..14314 + 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
BE939_RS00470 (BE939_00465) 14413..14808 + 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
BE939_RS00475 (BE939_00470) 14841..15206 + 366 WP_000994779 type IV conjugative transfer system pilin TraA -
BE939_RS00480 (BE939_00475) 15221..15532 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
BE939_RS00485 (BE939_00480) 15554..16120 + 567 WP_000399785 type IV conjugative transfer system protein TraE traE
BE939_RS00490 (BE939_00485) 16107..16835 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
BE939_RS00495 (BE939_00490) 16835..18262 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
BE939_RS00500 (BE939_00495) 18252..18842 + 591 WP_000002792 conjugal transfer pilus-stabilizing protein TraP -
BE939_RS00505 (BE939_00500) 18829..19026 + 198 WP_001324648 conjugal transfer protein TrbD -
BE939_RS00510 (BE939_00505) 19038..19289 + 252 WP_001038342 conjugal transfer protein TrbG -
BE939_RS00515 (BE939_00510) 19286..19801 + 516 WP_000809841 type IV conjugative transfer system lipoprotein TraV traV
BE939_RS00520 (BE939_00515) 19936..20157 + 222 WP_001278689 conjugal transfer protein TraR -
BE939_RS00525 (BE939_00520) 20317..22944 + 2628 WP_078232963 type IV secretion system protein TraC virb4
BE939_RS00530 (BE939_00525) 22941..23327 + 387 WP_000097319 type-F conjugative transfer system protein TrbI -
BE939_RS00535 (BE939_00530) 23324..23956 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
BE939_RS00540 (BE939_00535) 23953..24945 + 993 WP_000830187 conjugal transfer pilus assembly protein TraU traU
BE939_RS00545 (BE939_00540) 24954..25592 + 639 WP_000777688 type-F conjugative transfer system pilin assembly protein TrbC trbC
BE939_RS00550 (BE939_00545) 25589..27397 + 1809 WP_000821847 type-F conjugative transfer system mating-pair stabilization protein TraN traN
BE939_RS00555 (BE939_00550) 27424..27681 + 258 WP_000864318 conjugal transfer protein TrbE -
BE939_RS00560 (BE939_00555) 27674..28417 + 744 WP_001030367 type-F conjugative transfer system pilin assembly protein TraF traF
BE939_RS00565 (BE939_00560) 28433..28780 + 348 WP_001287913 conjugal transfer protein TrbA -
BE939_RS00570 (BE939_00565) 28782..29096 - 315 WP_000415567 hypothetical protein -
BE939_RS00575 (BE939_00570) 29177..29461 + 285 WP_000624109 type-F conjugative transfer system pilin chaperone TraQ -
BE939_RS00580 (BE939_00575) 29448..29993 + 546 WP_000059850 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
BE939_RS00585 (BE939_00580) 29923..30264 + 342 WP_001443031 P-type conjugative transfer protein TrbJ -
BE939_RS00590 (BE939_00585) 30251..30632 + 382 Protein_49 F-type conjugal transfer protein TrbF -
BE939_RS00595 (BE939_00590) 30632..32005 + 1374 WP_021553026 conjugal transfer pilus assembly protein TraH traH
BE939_RS00600 (BE939_00595) 32002..34818 + 2817 WP_001007054 conjugal transfer mating-pair stabilization protein TraG traG
BE939_RS00605 (BE939_00600) 34851..35372 + 522 WP_000632670 conjugal transfer entry exclusion protein TraS -
BE939_RS00610 (BE939_00605) 35397..36128 + 732 WP_000850422 conjugal transfer complement resistance protein TraT -
BE939_RS00615 (BE939_00610) 36381..38534 + 2154 WP_000009350 type IV conjugative transfer system coupling protein TraD virb4
BE939_RS00620 (BE939_00615) 38543..38941 - 399 WP_000911324 type II toxin-antitoxin system VapC family toxin -
BE939_RS00625 (BE939_00620) 38941..39168 - 228 WP_000450532 toxin-antitoxin system antitoxin VapB -

Host bacterium

ID   1381 GenBank   NZ_CP019007
Plasmid name   pECAZ159_1 Incompatibility group   IncFIB
Plasmid size   128248 bp Coordinate of oriT [Strand]   12694..12983 [-]
Host baterium   Escherichia coli strain Ecol_AZ159

Cargo genes

Drug resistance gene   sitABCD
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -